KEGG   Bacillus thuringiensis MC28: MC28_3685Help
Entry
MC28_3685         CDS       T02263                                 

Gene name
uvrC
Definition
UvrABC system protein C
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:btm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MC28_3685 (uvrC)
Enzymes [BR:btm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MC28_3685 (uvrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3567227..3569563)
Genome map
AA seq 778 aa AA seqDB search
MGNQHAMDLFEEEKKFIKAQVLHTIFHNEENLYSVVSMKIIETNETYDEKKVMINGHFPR
MHEDEVFTLTGHFKDHPKYGKQYLVETFKKELPQTKAGMVQYLASDLFKGIGKRTAEKIV
DHLGEHAISKIMDDPDALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNGYGFGTKLSIKI
YQQYKEMTLEVIRNNPYQLIEEVDGIGFGRADDIGRALGISGNHDDRVRAGCFYTLENVS
LQLGHVYMGKDQLVRETMSLLNNQEGRVTEEDIIGCVEMMQSEGKVIIEEERVYLASLFY
SEKGVVKSIRRLMNQEETPSFPEAEMLKTLGEIEEQLKVQYAPFQQEAIQTALHKPMMLL
TGGPGTGKTTVIKGIVEMYASLHGVSLNLNEYSDDNPFPILLTAPTGRAAKRMSESTGLP
ACTIHRLLGWTPEGSFQRNETDPVQGKLLIIDEFSMVDIWLANQLFKSLPTNIQVIVVGD
EDQLPSVGPGQVLKDLLNAGAIPTVKLTEIYRQAEGSSVIQLAHAIKDGTLPPDLAQNKK
DRSFISCAGAQIVEVVKKVCENAKTKGFSARDVQVLAPMYRGPAGINVLNEALQEVFNPK
KEKSKEIAYGDVVYRRGDKVLQLVNQPESQVFNGDIGEIVSVFYAKENVEQQDMIIVSFD
GIEVTYTKPDLNQITHAYCCSIHKSQGSEFPIVIMPIVKSYYRMLRRNLIYTGITRSKKF
LIICGEEAAFQSGVNRLDDAMRQTTLAGRLQESQGEVQMVTVNGEEMDVENISPYDFM
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcaacatgccatggatttgtttgaggaagagaaaaaatttataaaagcgcaa
gttcttcataccattttccacaacgaagaaaacctctattccgttgtcagtatgaaaatc
attgaaacgaatgaaacatacgacgaaaaaaaagtaatgataaacggtcattttccccgt
atgcatgaagatgaagtgtttacattaacaggtcattttaaagaccacccgaagtatggg
aaacaatatttagttgaaacgtttaagaaagaattgccgcaaacaaaagcaggtatggtg
caatatttagcgagcgatttatttaaagggattggaaagcgtacggctgaaaaaatcgta
gatcaccttggtgagcatgccatttctaaaattatggatgatcctgatgcgttaaatggt
gttgttaacaaacaaaaagcacaggaaatatatgagacaattgtggagcatcaagggtta
gagaaagtaatgagctttttaaatggttacggttttggaacgaagctttctattaaaatt
tatcagcaatataaagaaatgacattagaagtgattcgtaataatccatatcaacttatt
gaagaagtggacgggattggttttggacgagcagatgatataggacgtgcgttaggtata
tcgggtaatcatgatgaccgtgtacgtgcgggatgtttttatacgttagagaatgtttca
ctgcagctcggccacgtttatatggggaaagatcaacttgtaagagaaacgatgtcactt
ttaaataatcaagaaggtagagtgactgaggaagacattataggctgtgttgaaatgatg
caaagtgaagggaaagtcatcattgaagaagaacgagtgtacttagcatcgttattttac
tctgaaaaaggtgttgtaaagtctattcgtaggcttatgaatcaagaggaaaccccttca
tttcctgaagcagaaatgttaaaaacattaggtgaaattgaagaacagctgaaggtgcag
tatgcaccgtttcagcaagaagcaattcaaacggcacttcataagccgatgatgttattg
acaggtggaccaggaacggggaaaacaacagttattaaaggaattgttgaaatgtacgcg
tccttgcatggggtatcattaaatctgaatgaatacagtgatgataatccatttccaata
ttattaacggctccaacaggaagagcagcgaagcgaatgagtgaatctaccgggctccct
gcttgtacaattcatcgtctgcttggttggacgccagaagggtctttccagcgtaatgaa
accgatccagttcaagggaagttactcattattgatgagttttcgatggtagatatttgg
cttgcaaatcagctattcaagtcacttccgacaaatattcaagttatcgttgtaggtgat
gaagatcagttgccatctgtaggacctggacaagtgttaaaagatttattaaatgcagga
gccattccaacggtaaaacttacagaaatttatcgtcaggcggaaggttcgtctgttatt
cagcttgcccatgcgataaaagacggaacacttccaccggatttagcgcaaaataaaaaa
gatcgttcatttatcagctgtgcaggggctcaaattgttgaagttgtaaaaaaagtatgt
gaaaacgcgaagacgaaagggtttagcgcaagagatgtccaagtgttggcacctatgtac
cgcggaccagcaggtattaatgtgttaaatgaagctcttcaagaagtgtttaatccgaaa
aaagaaaaaagtaaagaaattgcctacggtgacgttgtgtatcgaagaggtgataaagta
cttcaattagtcaatcagccggaaagccaagtatttaatggtgatattggagaaattgtt
tcggtgttttatgcaaaagaaaatgttgagcaacaggacatgattatcgtttcatttgat
ggaatcgaagtaacgtatacaaagccggatttaaatcaaattacccatgcatattgctgc
tcgattcataaatcacaaggtagtgaatttccaatagttattatgccgattgtaaagagc
tactaccgtatgttacgtcgtaatttaatttacacgggcattacaagaagtaagaaattc
cttattatttgtggggaggaagcggcttttcaatccggtgtaaatcgccttgacgatgca
atgcgtcaaacgactttagctggtcgtttgcaagaatcacaaggagaggtgcagatggta
acggttaatggcgaggaaatggacgtggaaaacatttcaccgtatgatttcatgtaa

DBGET integrated database retrieval system