KEGG   Bacillus thuringiensis MC28: MC28_3713Help
Entry
MC28_3713         CDS       T02263                                 

Definition
cell surface protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:btm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3598165..3598758)
Genome map
AA seq 197 aa AA seqDB search
MEYVGPEYVVIDHNGIGYQIFTPNPYVFQRSKQEIRVYTYHYVREDIMALYGFKTREERL
LFTKLLGVSGIGPKGALAILASGQTGQVVQAIEHEDEKFLVKFPGVGKKTARQMILDLKG
KLADVVPDAFVDLFSDVESFDEKKGSSVELDEALEALRALGYAEREVSRVVPELLKESLT
TDQYIKKALSLLLNGKR
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtggagtatgtaggaccggaatatgtcgtaattgaccataatggaattgggtaccaaatt
ttcacaccaaatccgtatgtatttcaaagaagtaagcaagaaatccgtgtctatacatat
cattatgtgagagaagatattatggcactttacgggtttaaaacacgtgaagagcgttta
ttatttacaaaattgttaggtgtgtctggcattgggccaaaaggcgctcttgcgatttta
gcttctggtcaaacaggacaggtcgttcaagcgattgaacatgaagatgagaagttttta
gtgaaattcccgggcgtcggaaagaaaacagcgcgccaaatgattttagatttaaaagga
aaactagcagatgttgtaccagatgcatttgttgatttgttctcagatgttgaaagtttt
gatgagaagaaaggttcctcagttgaacttgatgaagcactggaagcactgcgtgcactt
ggttatgcagaacgggaagtttctcgtgttgtaccagagttattaaaagaatcattaacg
acggatcaatatattaaaaaggcacttagtcttttactaaatggtaagaggtga

DBGET integrated database retrieval system