KEGG   Bacillus thuringiensis MC28: MC28_3802Help
Entry
MC28_3802         CDS       T02263                                 

Definition
metal-dependent hydrolase
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:btm01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:btm00071]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3687237..3687971)
Genome map
AA seq 244 aa AA seqDB search
MATLNHGPANAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEGRFFSAGADIKEFTSVTEA
KQATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMRFVTESAKLGLPELT
LGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGVFSEETLLDDTLKVA
KQIAGKSLATTRAVLELLQTTKSSHYYEGVQREAQIFGEVFTSEDGREGVAAFLEKRKPS
FSGR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacgttaaatcacgggccagcgaatgcgatgtcttcacaagttatgcatgacgtt
actgagttaattgatcaagtggagaaggatgataacattcgtgttgttgttattcacggt
gaagggcgcttcttctcagctggagcagatattaaagaatttacatctgttactgaagcg
aagcaagcgacagaattagcacagcttggacaagttacatttgagcgtgttgaaaaatgt
tcaaaaccagttatcgcggcaattcatggagcggcacttggcggcggccttgagtttgct
atgtcttgccacatgcgctttgtaactgaaagtgcaaaacttggtttacctgaattaaca
cttggattaattcctggttttgcaggtacacagcgcttaccacgttatgttgggaaagcg
aaagcttgtgaaatgatgttaacgagtacaccaattactggtgcagaagcattaaaatgg
ggacttgttaacggagtgttttctgaagaaacacttttagacgatacacttaaagttgca
aaacaaattgctggaaaaagtctagcaacaactcgtgctgtgttagagttattgcaaacg
acaaaatcgtctcattattacgaaggtgtacagcgcgaagctcaaatcttcggtgaagta
tttacgagtgaagatggaagagaaggtgtagcagcgtttttagaaaaacgtaagccttcg
tttagtggtaggtag

DBGET integrated database retrieval system