KEGG   Bacillus thuringiensis MC28: MC28_3864Help
Entry
MC28_3864         CDS       T02263                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:btm03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3750914..3751744)
Genome map
AA seq 276 aa AA seqDB search
MPELPEVENVRRTLENLVTGKTIEDVIVTYPKIVKRPDDAEIFKEMLRGEKIETIKRRGK
FLLLYVTNYVIVSHLRMEGKFLLHQEDEPIDKHTHVRFLFTDGTELHYKDVRKFGTMHLF
KKGEELNQMPLVDLGPEPFDAELTPQYLQEKLQKTNRKIKVVLLDQRLLVGLGNIYVDEV
LFRSHIHPEREAASLTQEEIERIYEAIVTTLGEAVKRGGSTIRTYMNSQGQIGSFQELLN
VYGKKGEPCVTCGTILEKTVVGGRGTHYCPICQPRI
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattaccagaggttgaaaacgtcagacggacactcgaaaatcttgtaacagga
aaaacgattgaagatgttattgttacgtatccaaaaatagtaaaacgaccagatgatgcg
gaaatctttaaagaaatgctcagaggcgagaaaattgaaacgataaagcgaagaggtaag
tttttgcttttatatgtaacgaattatgttatcgtttcacatttgcgtatggaaggaaag
tttttactgcatcaagaggatgagccaattgataagcatacgcacgtccgtttcttattt
acagatggaactgaattacattataaagatgtgagaaagtttggtacgatgcatctcttt
aaaaaaggtgaagagttaaatcaaatgcctcttgttgacttaggtccagagccatttgat
gctgaattgacaccacagtatttacaagaaaaattgcaaaagacaaatcgtaaaataaaa
gtcgtattattagatcagcgtcttttagtagggcttggaaatatatatgtagatgaagtt
ttattccgttctcatatccatccagagcgagaagctgcatctttaacgcaagaagaaatc
gaaagaatttacgaagcaattgttacaacgctaggcgaagcagtgaagcgaggcggaagc
acaattagaacgtatatgaattcgcaagggcaaattggttcattccaagaacttttaaat
gtatatgggaaaaagggagaaccatgtgtaacttgtggcacgatattagaaaaaacagtt
gttggcggaagagggacgcattattgcccaatttgtcagcctagaatatag

DBGET integrated database retrieval system