KEGG   Bacillus thuringiensis MC28: MC28_3923Help
Entry
MC28_3923         CDS       T02263                                 

Definition
(GenBank) Acetate-CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm00010  Glycolysis / Gluconeogenesis
btm00620  Pyruvate metabolism
btm00640  Propanoate metabolism
btm00680  Methane metabolism
btm01100  Metabolic pathways
btm01110  Biosynthesis of secondary metabolites
btm01120  Microbial metabolism in diverse environments
btm01130  Biosynthesis of antibiotics
btm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MC28_3923
   00620 Pyruvate metabolism
    MC28_3923
   00640 Propanoate metabolism
    MC28_3923
  Energy metabolism
   00680 Methane metabolism
    MC28_3923
Enzymes [BR:btm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MC28_3923
Lipid biosynthesis proteins [BR:btm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MC28_3923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFU15345
UniProt: K0FZP1
Position
complement(3806680..3808272)
Genome map
AA seq 530 aa AA seqDB search
MFMKREELLAPPSYNLVSEIEKYTDDKEKLALIWQDDKGNRREVTYFELMQGANKIGNAF
IKSGLQKGDKLLIMMPRLIEAYMTYIAAIKAGFVVIPSSEMLRKKDIEYRIGHGEVKAIV
SYEPYIGQFDNIGAMESLQKFVLSEQSVDGWINLKTALETESDMLEMAKTDKEDMVFLSY
TSGTTGNPKGVVHTHAWAYAHLRTSAPNWLGIEENDVVWATASPGWQKWIWSPFLATLGS
GATGFVYNGKFEPKTYLNLLDDNKVNVLCCTPTEYRLMAKVEDLTEYNLEALHSAVSAGE
PLNREVIETFQKHFDITVRDGYGQTENTLLVGVMKGMDIRPGSMGKPTPGNHVDIVNEEG
IPVQVGEVGDIAVHIETPALFKQYYKDDERTAMQFRGDYYITGDKAKKDEDGYFWFEGRG
DDIIISSGYTIGPFEVEDALVKHPYVRECAVVASPDEIRGSVVKAFIVLRENIEKNEEIL
IPVLQQHVKELTAPYKYPRKIEFVDELPKTISGKIRRIELRKQEMELPSK
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtttatgaagagagaggaattgttggcaccaccatcttataatttagtttcagaaata
gagaaatatacagacgataaagagaagcttgctttaatttggcaagatgataaagggaat
agacgagaagttacatattttgaattaatgcaaggtgcaaataaaattggaaacgctttt
ataaaaagtggcttacaaaaaggggacaagctccttattatgatgccgcgtttaattgaa
gcttacatgacgtatatcgctgcgattaaagcaggatttgtcgtaattccgagttcggaa
atgttgcgtaaaaaagatattgaataccgcattggacacggagaagtaaaagcgattgta
agttatgaaccatatatcggacagtttgataacataggggcgatggaatctcttcaaaag
ttcgttctgagcgagcagtcagtagacggatggatcaatttaaaaacagcattagaaaca
gaaagtgacatgttagaaatggcgaaaacagataaagaagatatggtctttttatcttat
acgtcagggacgacaggaaacccgaaaggagttgttcatacgcatgcgtgggcatacgct
catttacgtacgagcgccccaaattggctcggaattgaagagaatgatgttgtatgggca
acggctagcccagggtggcaaaagtggatttggagcccgtttttagccactctcggttca
ggggcaacaggatttgtatacaacggtaagtttgaaccgaaaacgtatttaaatttatta
gacgataataaggtgaatgtgctttgttgtacaccgactgagtatagattaatggcaaag
gtagaagacttgactgagtacaatttagaagcgttacatagcgctgtatccgcaggtgag
ccgttaaatagagaagtcattgaaacgttccaaaagcactttgatattacagtaagagat
ggctatgggcaaacggaaaatacattacttgttggcgtaatgaaagggatggatattaga
ccgggatcaatggggaaaccaacgccaggaaaccatgttgatatcgttaatgaagaagga
atcccagtgcaggtaggagaagttggcgatattgcagttcatattgaaacaccagccctc
tttaagcaatattataaagatgatgaacgcacagcgatgcaattccgtggtgattattat
attacgggtgataaagcgaaaaaagatgaagacggctatttctggtttgaagggcgcgga
gatgatattatcattagctctggttacacaatcgggccgttcgaagttgaagatgcactt
gtaaaacatccttacgtaagagaatgtgcggttgtcgcaagtccggatgaaattcgaggg
agtgtcgtgaaggcatttatcgtattaagagagaatatagaaaagaacgaagaaatatta
attccagtgctccaacaacacgtgaaagaactcactgcaccatataaatatcctcgcaaa
attgaatttgtagatgaactaccaaaaacgatttccggaaaaattcgtcgtattgaactt
agaaaacaagagatggagctcccttccaaataa

DBGET integrated database retrieval system