KEGG   Bacillus thuringiensis MC28: MC28_3942Help
Entry
MC28_3942         CDS       T02263                                 

Definition
Heme/copper-type cytochrome/quinol oxidase, subunit 4
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MC28_3942
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MC28_3942
   00620 Pyruvate metabolism
    MC28_3942
   00640 Propanoate metabolism
    MC28_3942
  Energy metabolism
   00680 Methane metabolism
    MC28_3942
Enzymes [BR:btm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MC28_3942
Lipid biosynthesis proteins [BR:btm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MC28_3942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3824363..3826081)
Genome map
AA seq 572 aa AA seqDB search
MKVETLPVIKGENNLPNYEEAYANFNWEEVNKHFTWNETGRVNMAYEAIDKHAKSDRKNK
VALYYQDGSRKEKYTFKEMKDFSNKAGNVLKNYGDVEKGDRVFIFMPRSPELYFALLGAV
KLGAIVGPLFEAFMEGAVRDRLEDSEAKVLITTPELLERIPLNDLPALKTVFLVGDNVEE
GGKTVAFNPLFEQASKELHIEWLGREDGLILHYTSGSTGKPKGVLHAQNAMVQHYQTAKW
VLDLKEDDVYWCTADPGWVTGTAYGIFAPWLVGASNVILGGRFSPDAWYEALQDYGVTVW
YSAPTAFRMLMGAGQDAIKKYDLSQVRHVLSVGEPLNPEVIRWGMNAFGLRIHDTWWMTE
TGGQVICNYPCMEIRPGSMGKPIPGVKAAIVDNEGNEVPPYTMGNLAIGKGWPAMMRGIW
NNKQKYESYFMPGDWYVSGDSAYMDEDGYFWFQGRIDDVIMTSGERVGPFEVESKLIEHA
AVAEAGVIGIPDPVRGEIIKAFIALRAGYEPSDELKEEIRQFVKKGLAAHAAPRQIEFRD
KLPKTRSGKIMRRVLKAWELNLPTGDLSTMED
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagaaacgcttcctgtcattaaaggagaaaataatttgccgaattatgaagag
gcatacgcgaattttaactgggaagaggttaataaacattttacttggaatgaaacaggc
cgagtaaatatggcgtatgaagcaattgataagcatgcgaaatctgatcgaaaaaataaa
gtagccctttattatcaagatggatcgcgaaaagagaaatatacatttaaggaaatgaag
gatttttctaataaagcaggaaacgtcctaaaaaattatggcgatgttgaaaaaggcgat
cgtgtttttatttttatgccacgttctccagaattatatttcgcgcttttaggtgcagtg
aaattaggagcaattgttggaccgctatttgaagcatttatggaaggcgcagttcgtgat
cgtttagaagatagcgaagcaaaggtgttaattacaactcctgaattgttagagcgtata
ccattaaatgatttaccagctttaaaaacagtctttcttgttggagataatgtagaagaa
ggcggtaaaacagtagcgttcaatcctttatttgaacaagcttcaaaagaattacatatc
gaatggttaggccgcgaagacggtttaattcttcactatacgtctggttctactggtaag
ccaaaaggtgttctccatgcgcaaaatgcaatggttcagcactatcaaacggcgaaatgg
gtattagatttaaaagaagatgacgtatattggtgtactgctgacccgggctgggtaacg
ggaactgcttacggcatttttgcaccgtggttagttggagcatcaaatgttattttaggt
ggacgatttagtccagatgcatggtatgaagcactgcaagattacggtgtaacagtttgg
tatagtgcaccgacagcgttccgtatgttaatgggagctggacaagatgcaattaaaaaa
tacgacttatcacaagtacgccacgtattaagcgtaggtgagcctttaaatccagaagta
attcgctggggtatgaatgcatttggacttcgtattcatgatacgtggtggatgacagaa
acaggtggacaagttatttgtaactatccgtgtatggaaatccgtccaggttcaatgggt
aaaccaattccaggtgtgaaagcagcgattgttgataatgaaggaaatgaagtgcctcca
tacacaatgggtaacttagcaattggtaaaggttggccagctatgatgcgtggaatctgg
aataacaagcaaaaatatgagtcatactttatgccgggagactggtatgtatcaggtgat
tcagcttatatggatgaagacggatacttctggttccaaggacgtattgacgatgtaatt
atgacgtcaggcgagcgcgttggaccgtttgaagtagaaagtaaactaatcgagcatgct
gctgttgcagaagctggtgtaattggtattcctgatccggtgcgcggcgaaattattaaa
gcgtttatcgcacttcgagcaggatacgaaccatctgatgaattaaaagaagaaattcgt
caatttgtaaaaaaaggcctagcagctcatgcagcgccacgacaaattgaatttagagat
aaattaccgaaaacgagaagtggtaaaattatgcgccgcgtattaaaagcgtgggagtta
aacttaccaacaggtgacttatcaacgatggaagattaa

DBGET integrated database retrieval system