KEGG   Bacillus thuringiensis MC28: MC28_3984Help
Entry
MC28_3984         CDS       T02263                                 

Definition
efflux ABC transporter ATP-binding protein
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:btm01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:btm00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3864449..3865855)
Genome map
AA seq 468 aa AA seqDB search
MSAINWTEEVAKRKDDLIRDTQQFLQIKSVWEEESAKEGAPFGEGVEKALSFMLHKGELE
GFSSKNLEGYAGHLEMGQGEELVGILCHVDVVPEGDGWTTPAYSADIREGKIFARGAIDD
KGPTMAAYYAMKIVKELGLPLSKRVRMILGTDEESNWKCVDHYFKNEEMPTIGFAPDADF
PIINAEKGISDIQVVQNGSEEKKGVYELVSFESGRRLNMVPDFAKAVITGEDVNALTVAY
EEYLQTAKKIGNSTIEGNTVMLQIEGISAHGSTPEKGENAGLLLANFLTTVSLDGKANAF
ATFAAETFTGDIFGEKATIAYKDEVSGPLTVNVGRLSYTKENGGNLGLNVRYPVTTNFEE
MIAKLKEYVSIHGFEVADYSNSRPHHVDKDHVLIRTLQRVYEEQTGEKAELLAIGGGTYA
RSLKAGVAFGPLFPGKEELAHQKDEYIEIEDLLKATAIYAQAIHELAK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgattaattggacagaagaagttgcaaaacgaaaagatgatttaattcgtgat
acacaacaatttttgcaaattaaaagtgtgtgggaagaagagtcggcgaaagagggcgca
ccgttcggtgaaggtgtagaaaaagctttatctttcatgttacataaaggagaattagaa
ggtttttcttctaaaaatttagaaggttatgcaggtcatcttgaaatgggacaaggagaa
gaactagtaggtattctttgtcatgttgatgttgtaccagaaggagatggctggacgact
cctgcatatagtgcagatattcgcgaaggaaagatttttgcacgtggtgcaattgatgat
aaaggcccaacgatggcagcttactatgcgatgaaaattgtgaaagaattagggttgcct
ctttcaaaacgcgttcgtatgattttaggaacagatgaagaaagtaactggaaatgtgta
gatcactactttaaaaacgaagaaatgccaacaatcggttttgcgccagacgcggatttt
ccaattattaatgcagaaaaaggaatttctgatatacaagttgtacaaaatggtagtgaa
gagaaaaaaggtgtatatgaactcgtttcatttgagtcaggccgccgtttaaacatggtt
cctgattttgcaaaagcggttattacaggagaagatgtaaatgcacttacagtagcatat
gaagagtatttacaaacggctaaaaaaatagggaactcaactatagaaggaaatacagtg
atgttgcaaatagaaggaatttcagcacacggatctactccagaaaaaggagaaaatgca
ggtttactattagcaaacttcttaactacagtttcacttgatggaaaagcaaatgcattt
gcgacatttgcagcagaaacatttactggtgatatttttggtgaaaaagctactattgct
tataaagacgaagttagcggtccgttaacagtgaatgtcggtcgcctttcttatacgaaa
gaaaacggtggtaacttagggttaaacgtacgttacccagttacgactaactttgaagaa
atgattgcgaagttaaaagaatacgttagtattcatggatttgaagtagcggattattct
aactctcgtccgcatcacgtcgataaagaccacgtattaattcgtacgctgcagcgcgtg
tatgaagaacaaacaggagaaaaagcagagctattagcaatcggcggtggtacttacgcc
cgttcattgaaagctggcgttgcatttggcccgctattccctggaaaagaagaacttgcg
catcaaaaagatgagtacattgaaattgaagacttattaaaagcaacagcaatttacgcg
caagcaattcatgaattagcgaaataa

DBGET integrated database retrieval system