KEGG   Bacillus thuringiensis MC28: MC28_4045Help
Entry
MC28_4045         CDS       T02263                                 

Definition
lipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MC28_4045
Enzymes [BR:btm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MC28_4045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3923538..3924383)
Genome map
AA seq 281 aa AA seqDB search
MYQIMKKSEMEEVCMWNYEAEEAKAVVVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLP
SHGTTSRNRGHIDSFDEYIEEVKLWVKEARKYRVPIFLFGHSMGGLIVIRMMQETKREDI
DGIILSSPCLGVLAAPAAPLRAASKILNVVAPKLQFATNLTVEMSTRNHEVRDAMENDSL
FLRKVSVRWYSELIKSIEIAHKKIDEFPDVPLLLMQACEDKLVDKTRVRMWFDNVKISDK
AYKEWPNCYHELLNEYERDEILNYIQAFTEIRINNIIETNK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgtatcaaattatgaaaaagagtgaaatggaggaggtctgtatgtggaattatgaagcg
gaggaagcgaaagctgtagtcgttattgtacacggcgcaatggaatatcacggacgctac
gaagcggtcgcggaaatgtggaatcatattggctaccacgtcgtgatgggagaccttccg
tcacatggaacgacttcgagaaatagaggacatattgattcatttgatgaatacatagaa
gaagttaaattatgggtgaaagaagcaagaaaatatcgggtacctatttttctattcggt
catagtatgggcggtcttatcgtgattcgtatgatgcaagaaacgaagagagaagatata
gatggtatcattttaagttcgccatgtttaggcgtattagctgcacctgctgctccactt
cgagcggcttcaaaaatattaaatgttgttgcaccaaaattgcaatttgcaacgaatctt
acagtggaaatgtcgacacgtaatcatgaagtgagagatgcgatggagaatgattctttg
ttcttgcgcaaagtgtcagtacgttggtatagtgaattaattaagtctattgaaattgct
cataaaaaaatagacgagtttccagacgttccactcttgctaatgcaagcatgtgaggat
aaacttgtagataaaacacgtgtccgcatgtggtttgataatgttaaaataagtgataag
gcatataaagaatggcctaattgttatcatgaattattaaatgagtatgagcgtgatgaa
attttgaattatattcaggcatttactgaaatacgtatcaataacataatagaaacaaat
aagtaa

DBGET integrated database retrieval system