KEGG   Bacillus thuringiensis MC28: MC28_4157Help
Entry
MC28_4157         CDS       T02263                                 

Definition
cytolysin immunity CylI domain-containing protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:btm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4029630..4031567)
Genome map
AA seq 645 aa AA seqDB search
MSVINCEKVKRDEFHTEKYYESYSIFGAHIVTEDEMRGVRFTVWAPHAKAMSVVGDFNEW
DYEQHKMLQETEEGIWSLFIPHIEEREIYKYAIETMAGDVIFKADPYAVYAEVRPNTASV
VFDMKGYEWNDKNWSRKKKKKPVYKEAMTVYELHFGSWKKKEDGTLYSYREMVEELIPYV
VEHQFTHIEIMPLVEHPYDRSWGYQGTGYYAATSRFGTPHDLMYFVDECHKYGIGVILDW
VPGHFCKDAHGLYLFDGTPTYEYKDKDVQENQVWGTVNFDLGKREVRNFLISNALFWMRY
FHIDGFRVDAVANMLYWNKEGQEQSNEHAVSFLRELNEAVFAEDEDFLMTAEDSTAWPLV
TAPTYEGGLGFNYKWNMGWMNDVLKYMECAPEYRKYIHEKITFSLLYAYSENFILPLSHD
EVVHGKKSLLNKMPGDYWDKFAQLRLLYGYLFTHPGKKLLFMGGEFGQFDEWKDLEDLDW
NLHDFEMHRYMHDYFKELIALYKRSKPLWQLDHSPEGFQWIDANNNEQSIFSFIRQGDKQ
EDALVVVCNFTKATYENYKVGVPDFEYYNEILNSDAEQYGGSGQVNKKRLKANLEPYHNQ
EAHVEITIPPFGVSILRPVKTRKGSKKQDGSKTKVRSNVTSRGKR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgtaataaattgtgaaaaagtgaaacgagatgagtttcatacagaaaagtactat
gagagttatagcatctttggcgcacatattgtaacggaagatgagatgcgaggggtacga
tttacagtatgggctcctcatgcgaaagcaatgagtgttgttggcgattttaatgaatgg
gattatgagcaacataagatgctacaagagacagaagagggaatttggtccttgtttata
ccgcatattgaagaaagggaaatatataaatatgcgattgaaacgatggctggtgacgtc
atttttaaggcagatccgtacgctgtatatgcagaagtaagaccgaatacggcatctgta
gtttttgatatgaagggatacgaatggaatgataaaaactggagtcgtaagaaaaagaaa
aagccggtttataaagaagcgatgacagtttatgaattacatttcggttcctggaagaag
aaagaagatggaacgctgtattcttatagggaaatggtagaagaactcattccgtatgtg
gtggaacatcaatttacacatattgaaatcatgccgcttgttgagcatccatatgatcgt
tcttggggatatcaagggacgggatattatgcagcaacgagtagattcggcacaccacat
gatttgatgtattttgtcgatgaatgtcataaatatggaatcggtgtcattttagattgg
gtgccggggcatttttgtaaagatgctcacggtctatatttgtttgatgggacaccgact
tatgaatataaagataaggatgtacaagaaaaccaagtatggggaactgtcaattttgat
ttaggaaaaagggaagtacgtaatttcttaatttcaaatgcgttattttggatgagatat
ttccatattgacggtttcagggtggatgcagttgcgaatatgttgtactggaataaagaa
ggacaggagcaaagtaatgagcacgctgtttcatttttacgagagttaaatgaagcggta
tttgcagaggatgaagacttccttatgacagcagaagattcaacagcttggccacttgta
acagctccaacttatgaaggtggacttggattcaattacaaatggaatatgggctggatg
aatgacgtgctgaaatatatggagtgtgcacctgaatacaggaagtatattcatgagaaa
ataacattctctttactatatgcttactctgaaaacttcatattaccgctttctcatgat
gaagtcgttcacgggaaaaagtcgttattaaataaaatgccaggagattactgggataag
tttgctcagcttcgtttattatatggatatttatttactcacccaggaaagaaattactt
ttcatgggaggagaatttgggcagtttgatgagtggaaagaccttgaagatttagattgg
aatttacatgattttgaaatgcatcgttatatgcatgattactttaaagagctcatagca
ttgtataagcgctcaaaaccactttggcagcttgatcattcacctgaaggatttcagtgg
attgatgctaataataatgagcaaagtattttctcgtttattcgtcaaggagataaacaa
gaagatgcgttagttgtcgtatgtaattttacgaaagctacatatgaaaactataaagta
ggtgtgccagatttcgagtattataacgagattttaaacagtgatgcggagcaatatggc
ggctcggggcaagtgaataaaaaacgtcttaaggcgaatctagaaccgtaccataatcaa
gaggcacatgtagaaattacaattccaccatttggcgtatccatattacgaccagtgaag
actagaaaggggagcaaaaaacaagatggctcaaaaacaaaagtgcgtagcaatgttact
agcagggggaaaaggtag

DBGET integrated database retrieval system