KEGG   Bacillus thuringiensis MC28: MC28_4362Help
Entry
MC28_4362         CDS       T02263                                 

Definition
glycosyl transferase group 1
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
btm  Bacillus thuringiensis MC28
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4224230..4224973)
Genome map
AA seq 247 aa AA seqDB search
MMKLASPKPFTFEGGDRAVLLLHGFTGNSADVRMLGRFLEKKGYTCHAPIYKGHGVPPEE
LVHTGPTDWWQDVTEAYQLLKDKGFEKIAVVGLSLGGVFSLKLAYTIPVLGVVPMCAPMY
IKSEETMYQGILAYAREYKKREQKSPEQIEQEMLEFQQTPMNTLKALQELIADVRNNVDM
IYAPTFVVQARHDEMINTDSANIIYNGVESTLKDIKWYEDSTHVITLDKQRDELHEDVYN
FLEQLDW
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaattagcatctccaaaaccatttacatttgagggtggagaccgcgctgtttta
ttactacatggattcacaggaaactcagctgatgtacgtatgttagggcgtttcttagaa
aagaaaggctatacttgtcatgcgccaatttataaaggacacggcgtaccaccagaagaa
cttgttcatacaggtcctacagattggtggcaagatgtaacggaggcatatcagctttta
aaagataaaggctttgagaaaattgctgtcgttggtttgtcactaggcggagtattttct
ctgaaattagcatatacaatccctgttttaggtgtggtaccaatgtgtgcaccgatgtat
attaagagtgaagaaacaatgtaccaaggtatattggcatatgctcgcgaatataaaaag
cgtgagcaaaaatcaccagagcaaattgaacaagaaatgttggaattccaacagacaccg
atgaatacattaaaagcattacaagagctaattgctgatgtacgtaataatgttgatatg
atttatgcaccgacgtttgttgtacaagcgcgtcatgatgaaatgattaatacggatagt
gctaacattatttataacggtgtagaatcaacgttaaaggacattaaatggtatgaagac
tctacgcatgtcattacacttgataagcaacgtgacgagctacatgaggatgtatataac
ttcttggagcaactagattggtaa

DBGET integrated database retrieval system