KEGG   Bacillus thuringiensis MC28: MC28_4369Help
Entry
MC28_4369         CDS       T02263                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase 1
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm00010  Glycolysis / Gluconeogenesis
btm00051  Fructose and mannose metabolism
btm00562  Inositol phosphate metabolism
btm01100  Metabolic pathways
btm01110  Biosynthesis of secondary metabolites
btm01120  Microbial metabolism in diverse environments
btm01130  Biosynthesis of antibiotics
btm01200  Carbon metabolism
btm01230  Biosynthesis of amino acids
Module
btm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
btm_M00002  Glycolysis, core module involving three-carbon compounds
btm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MC28_4369 (tpiA)
   00051 Fructose and mannose metabolism
    MC28_4369 (tpiA)
   00562 Inositol phosphate metabolism
    MC28_4369 (tpiA)
Enzymes [BR:btm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MC28_4369 (tpiA)
Exosome [BR:btm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MC28_4369 (tpiA)
  Exosomal proteins of bladder cancer cells
   MC28_4369 (tpiA)
  Exosomal proteins of melanoma cells
   MC28_4369 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFU15791
UniProt: K0FUT5
Position
complement(4230725..4231480)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGTDLQ
VGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTLAAFEHG
LTPIVCCGETLEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSS
ADANEVCAHIRKVVAEAVSPEAAEAVRIQYGGSVKPENIKEYMAQSDIDGALVGGASLEP
ASFLGLLGAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgcaggtaactggaaaatgaataaaactctatctgaagcagtt
agcttcgtagaggaagttaaaggtcaaatcccagcagcttcagctgttgatgcagtagtt
tgctctccagctctattcttagagcgcttagtagcggcaactgaaggaacggacttacaa
gtaggtgcacaaaacatgcacttcgaaaaaaatggtgcattcactggcgaaattagccca
gtagcacttagcgacttaaaagtaggctacgtagtacttggccactctgagcgtcgtgaa
atgtttgctgaaacagacgaatcagtaaacaaaaagactcttgcagcatttgaacatggt
ttaacaccaatcgtatgttgtggtgagactttagaagagcgcgaaagcggaaaaacattt
gatctagtagcaggtcaagtgacaaaagcacttgcaggtttaacagaagagcaagttaaa
gcaactgttatcgcttatgagccaatctgggctatcggtacaggtaaatcatcttcttct
gcagatgcaaacgaagtatgtgcgcacatccgtaaagttgttgcagaagctgtttctcca
gaagctgcagaagctgttcgtattcaatacggcggtagcgtaaaaccagaaaacattaaa
gagtatatggcacaatctgacatcgacggcgctttagttggcggtgctagcttagagcct
gcttcgttcttaggtcttctgggggcggtaaaatga

DBGET integrated database retrieval system