KEGG   Bacillus thuringiensis MC28: MC28_4369Help
Entry
MC28_4369         CDS       T02263                                 

Definition
Tyrosine-protein kinase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MC28_4369
   01230 Biosynthesis of amino acids
    MC28_4369
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MC28_4369
   00051 Fructose and mannose metabolism
    MC28_4369
   00562 Inositol phosphate metabolism
    MC28_4369
Enzymes [BR:btm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MC28_4369
Exosome [BR:btm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MC28_4369
  Exosomal proteins of bladder cancer cells
   MC28_4369
  Exosomal proteins of melanoma cells
   MC28_4369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4230725..4231480)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGTDLQ
VGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTLAAFEHG
LTPIVCCGETLEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSS
ADANEVCAHIRKVVAEAVSPEAAEAVRIQYGGSVKPENIKEYMAQSDIDGALVGGASLEP
ASFLGLLGAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgcaggtaactggaaaatgaataaaactctatctgaagcagtt
agcttcgtagaggaagttaaaggtcaaatcccagcagcttcagctgttgatgcagtagtt
tgctctccagctctattcttagagcgcttagtagcggcaactgaaggaacggacttacaa
gtaggtgcacaaaacatgcacttcgaaaaaaatggtgcattcactggcgaaattagccca
gtagcacttagcgacttaaaagtaggctacgtagtacttggccactctgagcgtcgtgaa
atgtttgctgaaacagacgaatcagtaaacaaaaagactcttgcagcatttgaacatggt
ttaacaccaatcgtatgttgtggtgagactttagaagagcgcgaaagcggaaaaacattt
gatctagtagcaggtcaagtgacaaaagcacttgcaggtttaacagaagagcaagttaaa
gcaactgttatcgcttatgagccaatctgggctatcggtacaggtaaatcatcttcttct
gcagatgcaaacgaagtatgtgcgcacatccgtaaagttgttgcagaagctgtttctcca
gaagctgcagaagctgttcgtattcaatacggcggtagcgtaaaaccagaaaacattaaa
gagtatatggcacaatctgacatcgacggcgctttagttggcggtgctagcttagagcct
gcttcgttcttaggtcttctgggggcggtaaaatga

DBGET integrated database retrieval system