KEGG   Bacillus thuringiensis MC28: MC28_4510Help
Entry
MC28_4510         CDS       T02263                                 

Gene name
gtaB
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
btm  Bacillus thuringiensis MC28
Pathway
btm00040  Pentose and glucuronate interconversions
btm00052  Galactose metabolism
btm00500  Starch and sucrose metabolism
btm00520  Amino sugar and nucleotide sugar metabolism
btm01100  Metabolic pathways
btm01130  Biosynthesis of antibiotics
Module
btm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MC28_4510 (gtaB)
   00052 Galactose metabolism
    MC28_4510 (gtaB)
   00500 Starch and sucrose metabolism
    MC28_4510 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    MC28_4510 (gtaB)
Enzymes [BR:btm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MC28_4510 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3 IspD Smr
Motif
Other DBs
NCBI-ProteinID: AFU15932
UniProt: K0FNH8
Position
complement(4373907..4374788)
Genome map
AA seq 293 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAIESGIEDIIIVTGKG
KRAIEDHFDHSFELEQNLLEKGKYEMLEKVQASSRINIHYIRQKEPKGLGHAVWCARKFI
GNEPFAVLLGDDIVQAETPCLRQLMDQYEGTQSSVIGVQTVPENETHRYGIIDPVEQTER
RYQVRQFVEKPAQGTAPSNLAIMGRYVLTPEIFMFLENQQTGAGGEIQLTDAIQRLNEIQ
RVFAYDFEGTRYDVGEKFGFIKTTIEMALQHKELKDELMEYMTELIKIENIHV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagtaagaaaagcaattattccagctgctggtcttgggacaagatttttacca
gcaacgaaagcgatgccgaaagaaatgttgccaatcgttgataagccgacaattcaatac
ataatagaagaagcgatagaatcaggaattgaagatattattattgttactggaaaagga
aagcgcgccattgaagatcattttgatcattcctttgaattagagcaaaaccttttggaa
aaagggaaatatgaaatgcttgagaaagtacaagcttcttcaagaattaacattcactac
ataagacaaaaggaaccgaaaggacttggacacgcagtatggtgtgcacgtaagtttatt
ggaaatgaaccatttgcggtattacttggtgatgatattgtccaagcagaaacgccatgt
ttacgtcaattaatggatcaatatgaaggtacacagtcgtcagttattggtgtacaaaca
gtacctgaaaatgaaacacatcgttacggtattatcgatccggttgaacaaaccgagcgt
cgttaccaagtacgtcaatttgttgaaaaaccagcccaaggaacagcgccatcaaattta
gcgattatgggtcgttacgtattaacaccagaaatttttatgtttttagagaaccaacag
acaggtgctggtggggaaattcaactgacagatgcgattcaacgattaaatgaaattcag
cgtgtatttgcctatgattttgaaggaactcgttatgatgttggtgagaagtttgggttt
attaaaacgacaattgaaatggcattacaacataaagaattaaaggacgaattaatggag
tatatgactgaacttataaaaatagaaaatatacatgtgtaa

DBGET integrated database retrieval system