KEGG   Bacillus thuringiensis MC28: MC28_4510Help
Entry
MC28_4510         CDS       T02263                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MC28_4510
   00052 Galactose metabolism
    MC28_4510
   00500 Starch and sucrose metabolism
    MC28_4510
   00520 Amino sugar and nucleotide sugar metabolism
    MC28_4510
Enzymes [BR:btm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MC28_4510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4373907..4374788)
Genome map
AA seq 293 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAIESGIEDIIIVTGKG
KRAIEDHFDHSFELEQNLLEKGKYEMLEKVQASSRINIHYIRQKEPKGLGHAVWCARKFI
GNEPFAVLLGDDIVQAETPCLRQLMDQYEGTQSSVIGVQTVPENETHRYGIIDPVEQTER
RYQVRQFVEKPAQGTAPSNLAIMGRYVLTPEIFMFLENQQTGAGGEIQLTDAIQRLNEIQ
RVFAYDFEGTRYDVGEKFGFIKTTIEMALQHKELKDELMEYMTELIKIENIHV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagtaagaaaagcaattattccagctgctggtcttgggacaagatttttacca
gcaacgaaagcgatgccgaaagaaatgttgccaatcgttgataagccgacaattcaatac
ataatagaagaagcgatagaatcaggaattgaagatattattattgttactggaaaagga
aagcgcgccattgaagatcattttgatcattcctttgaattagagcaaaaccttttggaa
aaagggaaatatgaaatgcttgagaaagtacaagcttcttcaagaattaacattcactac
ataagacaaaaggaaccgaaaggacttggacacgcagtatggtgtgcacgtaagtttatt
ggaaatgaaccatttgcggtattacttggtgatgatattgtccaagcagaaacgccatgt
ttacgtcaattaatggatcaatatgaaggtacacagtcgtcagttattggtgtacaaaca
gtacctgaaaatgaaacacatcgttacggtattatcgatccggttgaacaaaccgagcgt
cgttaccaagtacgtcaatttgttgaaaaaccagcccaaggaacagcgccatcaaattta
gcgattatgggtcgttacgtattaacaccagaaatttttatgtttttagagaaccaacag
acaggtgctggtggggaaattcaactgacagatgcgattcaacgattaaatgaaattcag
cgtgtatttgcctatgattttgaaggaactcgttatgatgttggtgagaagtttgggttt
attaaaacgacaattgaaatggcattacaacataaagaattaaaggacgaattaatggag
tatatgactgaacttataaaaatagaaaatatacatgtgtaa

DBGET integrated database retrieval system