KEGG   Bacillus thuringiensis MC28: MC28_4734Help
Entry
MC28_4734         CDS       T02263                                 

Definition
drug resistance transporter, Bcr/CflA
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MC28_4734
   00240 Pyrimidine metabolism
    MC28_4734
Enzymes [BR:btm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     MC28_4734
    2.7.1.76  2'-deoxyadenosine kinase
     MC28_4734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4619009..4619677)
Genome map
AA seq 222 aa AA seqDB search
MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTR
WSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKG
LFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINN
FNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaggcaaaaatatgatataccgaatgatgcagtaattactatcgctggaaca
gtaggtgtcggaaaatcaactatgacaactgcactagctaacgctttaggttatcgcaca
tcatttgaaaaagtagattctaatccatatttggacaagttctatgccgatttcacacgc
tggagcttccacttgcaagtatacttcttagcagaacgatttaaagaacaaaagagaatt
tttgaatacggtggtggttttgttcaagaccgttctatctatgaagacactggaattttc
gcaaagatgcatcatgaaaaaggtacaatgacggaaactgattatgaaacatacaaaggt
ttatttgatgctatggtcatgactccttacttccctcatccagacttattaatttactta
gaaggttctttcgatgatattgtagaccgtattcaagaacgcggacgcccgatggagcag
caaacaccaattgaatattggaaagagatgcacggacgttacgaaaactggattaacaac
ttcaattcatgccctgttttacgattaaacattaatgaatacgatattttaaaagatggc
gattcaatcgaaccaatcattaaaaaaattggccatttcttaaaacaaacacgtaaactt
gtaaaataa

DBGET integrated database retrieval system