KEGG   Bacillus thuringiensis MC28: MC28_4734Help
Entry
MC28_4734         CDS       T02263                                 

Definition
drug resistance transporter, Bcr/CflA
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:btm00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:btm00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4619009..4619677)
Genome map
AA seq 222 aa AA seqDB search
MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTR
WSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKG
LFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINN
FNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaggcaaaaatatgatataccgaatgatgcagtaattactatcgctggaaca
gtaggtgtcggaaaatcaactatgacaactgcactagctaacgctttaggttatcgcaca
tcatttgaaaaagtagattctaatccatatttggacaagttctatgccgatttcacacgc
tggagcttccacttgcaagtatacttcttagcagaacgatttaaagaacaaaagagaatt
tttgaatacggtggtggttttgttcaagaccgttctatctatgaagacactggaattttc
gcaaagatgcatcatgaaaaaggtacaatgacggaaactgattatgaaacatacaaaggt
ttatttgatgctatggtcatgactccttacttccctcatccagacttattaatttactta
gaaggttctttcgatgatattgtagaccgtattcaagaacgcggacgcccgatggagcag
caaacaccaattgaatattggaaagagatgcacggacgttacgaaaactggattaacaac
ttcaattcatgccctgttttacgattaaacattaatgaatacgatattttaaaagatggc
gattcaatcgaaccaatcattaaaaaaattggccatttcttaaaacaaacacgtaaactt
gtaaaataa

DBGET integrated database retrieval system