KEGG   Bacillus thuringiensis MC28: MC28_4740Help
Entry
MC28_4740         CDS       T02263                                 

Definition
oligopeptide ABC transporter substrate-binding protein
Orthology
K06187  
recombination protein RecR
Organism
btm  Bacillus thuringiensis MC28
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:btm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MC28_4740
DNA repair and recombination proteins [BR:btm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MC28_4740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4624119..4624715
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVC
GHITDRDPCYICDDSHRDQTVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMEGIGPE
DINIPQLLKRLHDETVQEVILATNPNIEGEATAMYISRLLKPTGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagagccaatatcaaaattaatcgatagttttatgaaattgccagggatc
ggaccgaaaacagcggttcgattggcatttttcgtattagatatgaaagaagacgatgtg
ttaggttttgcgaaagcacttgtgaatgcgaagcgagatctagcgtattgttctgtatgc
ggacatattactgaccgtgatccttgttatatttgtgatgattcacatcgagatcaaacg
gttgtctgtgtcgtgcaagaaccgaaagatgtaatcgcgatggaaaaaatgaaagagtat
caaggtgtatatcatgtgttacgtggtgcgatttccccgatggagggaattggaccggaa
gacattaatatcccgcaactcttaaagcgactgcacgatgaaacggtacaagaagtgata
ttggcaacaaaccctaacattgaaggggaagctacagcgatgtatatatcccgcctctta
aagccgacaggtattaaagtaactcgtattgcacatggtctaccagttggtggagattta
gaatatgcagatgaagtaactctgtcaaaagcgctagaaggccgcagagaagtataa

DBGET integrated database retrieval system