KEGG   Bacillus thuringiensis MC28: MC28_4788Help
Entry
MC28_4788         CDS       T02263                                 

Definition
lipoprotein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:btm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4674460..4674975
Genome map
AA seq 171 aa AA seqDB search
MNNIAYIALGSNIGERYTYLTEAIQFLNKSPYIQVDDISSVYETDPVGYTDQSCFLNLVI
KISTNLSPQELLKVTQKVENDLGRKREIRWGPRTIDLDILLYNQENIEAENLIVPHPRMF
ERAFVIVPLLEINQDIKQDISRSQVEEMKRREGVTVWKQKNGEDAFVLFES
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatagcgtacattgcattaggttcgaatattggagagcgttatacgtattta
actgaagcgattcagtttttaaataaaagtccgtatatccaagttgatgatatttcatca
gtgtatgaaactgatccagttggctatactgaccaaagttgctttttaaatttagttata
aaaatttctaccaatttatcaccacaagaattattgaaagtaacgcaaaaagtagagaat
gacctaggaagaaaaagggaaattagatggggtccgagaaccatcgaccttgacatctta
ctctataatcaagaaaatattgaagcagagaatcttattgttccgcatccgcggatgttc
gaaagagcttttgttatcgttccgttgttagaaattaatcaagatataaaacaagacatt
tcacgttcacaagtagaagaaatgaaaaggcgagagggagtaacggtatggaagcagaaa
aatggggaagacgcattcgtgcttttcgaaagctga

DBGET integrated database retrieval system