KEGG   Bacillus thuringiensis MC28: MC28_4865Help
Entry
MC28_4865         CDS       T02263                                 

Gene name
pcrB
Definition
glycerol-1-phosphate prenyltransferase (EC:2.5.1.-)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MC28_4865 (pcrB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MC28_4865 (pcrB)
Enzymes [BR:btm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MC28_4865 (pcrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4748398..4749291
Genome map
AA seq 297 aa AA seqDB search
MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVVERIEEIGYDVKDMGDICIEREKEVDE
NTKLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGTLAGVAKHYKNLGVIWY
DAHGDLNTEETSPSGNIHGMSLAASLGYGHPTLVDLYGAYPKVKKENVVIIGARALDEGE
KDFIRNEGIKVFSMHEIDRMGMTAVMEETIAYLSHTDGVHLSLDLDGLDPHDAPGVGTPV
IGGLSYRESHLAMEMLAEADIVTSAEFVEVNTILDERNRTATTAVALMGSLFGEKLK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaatctcagttattggagttccaatggatttaggacagatgcgtcgtgga
gttgatatgggcccgagcgcgatccgttatgcaggggtagttgaaagaattgaagaaatt
ggatatgacgttaaagatatgggagatatatgtatagagagagaaaaagaagttgatgaa
aatacaaaattaagaaaccttacacaagttgcgactgtatgtaatgaattggcaagtaag
gtggatcatattatagaagaaggtcgttttccacttgtattaggtggtgaccatagtatc
gcaattggtacactagctggtgtggcaaaacattataaaaatttaggtgttatttggtat
gatgcacatggagatttaaatacggaggaaacttcaccatctggtaatattcatggaatg
tcacttgcagcaagtttaggctatggacatcccacgcttgtagacttatacggagcatat
ccaaaggtgaaaaaagagaacgttgtaattatcggtgcacgtgcattggatgaaggagaa
aaagactttattcgcaatgaaggtattaaagtattctcgatgcatgaaatcgatcgtatg
ggtatgacggctgttatggaagaaacaattgcttatttatctcatactgatggtgtacat
ctatcattagatttagatggtcttgatcctcatgatgcaccaggagttggaacgcctgta
attggtggtctatcgtatcgtgaaagtcatttagcgatggaaatgttagcggaagctgat
attgttacatctgctgagtttgttgaagtaaatacgattttagatgagagaaatagaacg
gcaacaaccgcggttgctttaatgggttctttattcggtgaaaaactaaaataa

DBGET integrated database retrieval system