KEGG   Bacillus thuringiensis MC28: MC28_5063Help
Entry
MC28_5063         CDS       T02263                                 

Definition
acetylornitine deacetylase (EC:3.5.1.16)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MC28_5063
Enzymes [BR:btm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MC28_5063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4996723..4997364
Genome map
AA seq 213 aa AA seqDB search
MLLQKEREEIVAYGRKMISSGLTKGTGGNISIFNREQGLVAISPSGLDYYETTPVDVVIL
NLDGEVVEGERKPSSELDMHLIYYRNREDINALVHTHSPYAKTIASLGWELPAVSYLIAF
AGPNVRCAPYETFGTKQLAEAAFEGMINRRAVLLANHGLIAGANNIKMAFTVAEEIEFCA
QIYYQTKSVGEPKLLPEDEMENLAKKFEGYGKQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaaaaagaaagagaagaaattgtagcgtacggaaggaaaatgatttctagc
ggtttaacaaaggggaccggcggaaatattagtattttcaatcgtgaacaaggcctagtt
gcaattagcccaagtggtttagattattatgaaacaacgcccgtggatgtagttatatta
aacttagatggtgaagtagtagaaggtgagagaaaaccgtcaagtgaactagatatgcat
cttatttattataggaatcgtgaagatataaatgcgctcgtgcatacacattcaccttat
gcgaagacgattgcatcattagggtgggagcttcctgctgtttcatatttaattgctttc
gcaggcccgaatgtacgctgtgcaccgtatgaaacatttggtacgaagcaattagcagag
gctgcttttgaaggcatgattaatcgccgtgcagtattacttgcgaaccacggtttaatt
gcaggtgcaaataatataaaaatggcatttactgttgcggaagaaattgagttttgtgcg
caaatttattatcaaacgaagagcgtcggagaaccgaagttattgccagaagatgagatg
gagaatttagcgaagaagtttgaaggatatgggaagcagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system