KEGG   Bacillus thuringiensis MC28: MC28_5388Help
Entry
MC28_5388         CDS       T02263                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MC28_5388
Enzymes [BR:btm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MC28_5388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5347388..5348293
Genome map
AA seq 301 aa AA seqDB search
MKQMPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTIPGGKGANQAVAAARLGANVAM
VGAVGNDDYGTVVRKNLENERVFIDYVVPVTDRTTGIAHIVLAEEDNSIVVVQGANALVN
ESVVDRSKDLLVKADMVVLQLEIPLETVKYVLSICEEHKIPVMLNPAPAQVLSEDILEKA
TYITPNEHECRIVLDDFTSPIEDLLAKYPNKLLMTEGSNGVRFHNGTEILHIPSIAVDVV
DTTGAGDTFNGALAVALSEGETLQKAIRFANIAGGLSVTKLGAQGGMPTRDRVREVQVIV
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagatgccaaatattgcagtagtaggtagtatttcaatggacttagtggctgtt
tcaaagaaacggccgaaagcaggagaaacagtaattggtgaagcatttcatacgatccca
ggagggaaaggggcgaaccaagcagttgctgcagctagattaggtgccaatgtagcaatg
gttggagcagtaggaaatgatgattacggaacagtagttagaaaaaatttagagaacgaa
cgtgtttttatcgactatgtggtaccggttacagatagaacgacaggaattgctcatatc
gttttagcagaagaggataacagtattgttgtcgtacaaggagcaaatgctcttgtgaat
gaatcggttgtagatcgttcaaaagatcttctcgtaaaagctgatatggttgttctacaa
ttagagattccgcttgaaacagtaaagtatgttctatctatttgcgaagaacataaaatt
ccagttatgttgaatccagcgccagcacaagtgttatcagaagacatattagaaaaggca
acgtatattacgccaaatgaacatgagtgccgcattgtattagatgattttacatcacca
attgaagatttactggcgaaatatccaaataaactattgatgacagaaggttctaacggt
gttcgtttccataatggtacggagattctacatattcctagcattgctgttgatgtagtg
gatacgactggagctggtgatacatttaatggtgcgttagcagttgcactttctgaagga
gaaacgcttcaaaaagcaattcgttttgcgaatattgctggaggcctttctgtaacaaaa
cttggggcacaaggcggtatgccaacgagagatagagtacgtgaagtgcaggtgattgtc
ggatga

DBGET integrated database retrieval system