KEGG   Bacillus thuringiensis MC28: MC28_E069Help
Entry
MC28_E069         CDS       T02263                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MC28_E069
   00052 Galactose metabolism
    MC28_E069
   00500 Starch and sucrose metabolism
    MC28_E069
   00520 Amino sugar and nucleotide sugar metabolism
    MC28_E069
Enzymes [BR:btm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MC28_E069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pMC189:complement(68336..69244)
Genome map
AA seq 302 aa AA seqDB search
MKIRRAIIPAAGLGTRFLPATKAQAKEMLPIVDKPTIQYIVEEAVASGIEEIIIIIGRGK
RSIEDHFDKSYELEDALLKKEKLDVLKEVQQISSLATIYYVRQKEPKGLGHAILCAQSFI
GNEPFAVLLGDDIVMSETPCLKQIIDVFEYCNSSIVAVQSVPEKDISKYGIIKPKGTMIQ
PNLFSVACLVEKPKKEMAPSRYAIMGRYVLRPEIFKILTKLSVDQANNELQLTDAINELN
KEQAVLAYNFEGNRYDIGDKVGFIKATIDFALHRDDIRNEVLAYLKDINAQDKFQITNEK
FE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcgaagggcgattattccggccgcaggtctcgggactagatttttgcctgca
acaaaagctcaggccaaagagatgctgccaattgttgataaacctacaattcaatatatt
gtagaagaagctgtagcttcagggatagaagaaattattatcataatagggagaggaaaa
agatcaatagaggatcactttgataaatcctacgaattagaagatgcacttttaaaaaaa
gaaaaactagatgttttaaaggaagttcagcaaatatctagtttagcaacaatttactat
gttcgtcaaaaggaaccgaaagggctagggcacgcaatactatgcgcccaaagctttatt
ggaaatgaaccttttgctgttttgttaggggatgacatcgttatgtccgaaacgccctgt
ctgaagcagattatcgatgtttttgagtattgcaatagctccatcgtggccgttcagagc
gtaccagaaaaggatatcagtaaatatggaattataaagccaaaagggacgatgattcaa
cctaacctttttagtgtcgcttgtttagtggaaaaacccaaaaaggaaatggctccttcc
agatatgcaataatggggcgttatgtcctaagacctgaaatttttaaaattctaacaaaa
ctctccgttgatcaagctaataatgaattacaattaacagatgctataaatgagttgaat
aaggagcaagctgtattagcatataattttgagggtaatcgatatgacattggtgataaa
gttggatttataaaagcaacaatagattttgctttgcacagggatgatattagaaatgaa
gttcttgcatatttaaaggacataaacgcacaagacaaatttcaaattacaaacgaaaag
tttgaataa

DBGET integrated database retrieval system