KEGG   Bacillus thuringiensis MC28: MC28_F192Help
Entry
MC28_F192         CDS       T02263                                 

Definition
DTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    MC28_F192
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MC28_F192
Enzymes [BR:btm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     MC28_F192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pMC319:220049..220633
Genome map
AA seq 194 aa AA seqDB search
MNGERRMRKIHTALDGVFIIELDKCSDKRGYFIETCNKKKFELLDLQGDFVQDNQSLSVH
TGTIRGLHYQLNPKAQMKVVSCISGSIYDVVVDIRKGSPTYGQWFGTILSEYNNRLLTVP
KGFAHGFCTTEPNTIVQYKVDEYYSPKHEGGILWDDETIGIFWPTNQPILSEKDRKLPRL
KDTNVNFVYGDDFN
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaatggagagagaagaatgcgtaaaattcatacagcattagatggtgtttttattata
gagcttgataaatgcagtgacaaacgtggttacttcattgaaacatgtaataagaaaaaa
tttgaactcttagatttacagggagactttgtacaagataatcaatcattatctgttcac
acaggcacgattcgtgggctgcattatcagttgaatcctaaagcccaaatgaaggtagta
agctgcatttctggttctatttacgatgtagttgtagatatccgaaagggctccccaacg
tatgggcaatggttcggaacaattttaagtgagtataataaccgtctacttaccgttcct
aaagggtttgcacatggtttttgtactacagaacctaatactattgtccagtataaagta
gatgagtattattcacctaaacatgaagggggaattctatgggatgatgaaacgataggg
attttttggccaactaatcaaccaattttatcagagaaagatagaaaactacctagatta
aaagatactaatgtcaactttgtttatggagatgattttaattga

DBGET integrated database retrieval system