KEGG   Bacillus thuringiensis HD-789: BTF1_01030Help
Entry
BTF1_01030        CDS       T02411                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
btn00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:btn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BTF1_01030
Enzymes [BR:btn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BTF1_01030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Guanylin
Motif
Other DBs
NCBI-ProteinID: AFQ24431
Position
229005..229901
Genome map
AA seq 298 aa AA seqDB search
MPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTIPGGKGANQAVAAARLGANVAMVGA
VGNDDYGTVVRKNLENERIFIDYVVPVTDRTTGIAHIVLAEEDNSIVVVQGANALVNKSV
VDRSKDLLVKADMVVLQLEIPLETVKYVLAICEEHNIPVMLNPAPAQVLSEEILEKATYI
TPNEHECRIVLDDFTSPIEDLLAKYPNKLLMTEGSNGVRFHNGTEIVHVPSIAVDVVDTT
GAGDTFNGALAVALSEGETLQKAIRFANIAGGLSVTKLGAQGGMPTRDRVREVQVIVG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatattgcagtagtaggaagcatttcaatggacttagtggctgtttcaaaaaaa
cggccgaaagcaggagaaacagtaattggtgaagcgtttcatacaatcccaggagggaaa
ggggcaaaccaagcagttgctgcagctaggttaggagcaaatgtagcgatggttggagcg
gtaggaaatgatgattatggaacagtagttagaaaaaatttagagaacgaacgcattttt
atcgattatgtggtaccggttacagatagaacgacaggaattgctcatatcgttttagca
gaagaagataacagtattgttgtcgtacaaggggcaaatgctcttgtaaataagtcagtt
gtagatcgctccaaagaccttcttgtaaaagcggatatggttgttcttcaactagaaatt
ccacttgaaacagtaaaatatgtattggctatttgtgaggaacataatattcctgttatg
ttgaatccagcgccagcacaagttttatcagaagaaattttagaaaaagcaacttatatt
acgccaaatgaacatgagtgccgcattgtattagatgattttacatcaccaattgaagat
ttattggcgaagtatccaaataaattattgatgacagaaggttctaacggtgttcgtttc
cataatggcacagagattgtacatgttcctagcattgctgttgatgtagtggatacaact
ggagctggtgatacatttaatggtgcgttagcagttgcactttctgaaggagagacactt
caaaaagcaattcgtttcgcgaatattgccggtggtctttctgtaacgaaacttggagca
cagggcggtatgccaacgagagatcgagtacgtgaagtgcaggtgattgttggatga

DBGET integrated database retrieval system