KEGG   Bacillus thuringiensis HD-789: BTF1_01030Help
Entry
BTF1_01030        CDS       T02411                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:btn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BTF1_01030
Enzymes [BR:btn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BTF1_01030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
229005..229901
Genome map
AA seq 298 aa AA seqDB search
MPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTIPGGKGANQAVAAARLGANVAMVGA
VGNDDYGTVVRKNLENERIFIDYVVPVTDRTTGIAHIVLAEEDNSIVVVQGANALVNKSV
VDRSKDLLVKADMVVLQLEIPLETVKYVLAICEEHNIPVMLNPAPAQVLSEEILEKATYI
TPNEHECRIVLDDFTSPIEDLLAKYPNKLLMTEGSNGVRFHNGTEIVHVPSIAVDVVDTT
GAGDTFNGALAVALSEGETLQKAIRFANIAGGLSVTKLGAQGGMPTRDRVREVQVIVG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatattgcagtagtaggaagcatttcaatggacttagtggctgtttcaaaaaaa
cggccgaaagcaggagaaacagtaattggtgaagcgtttcatacaatcccaggagggaaa
ggggcaaaccaagcagttgctgcagctaggttaggagcaaatgtagcgatggttggagcg
gtaggaaatgatgattatggaacagtagttagaaaaaatttagagaacgaacgcattttt
atcgattatgtggtaccggttacagatagaacgacaggaattgctcatatcgttttagca
gaagaagataacagtattgttgtcgtacaaggggcaaatgctcttgtaaataagtcagtt
gtagatcgctccaaagaccttcttgtaaaagcggatatggttgttcttcaactagaaatt
ccacttgaaacagtaaaatatgtattggctatttgtgaggaacataatattcctgttatg
ttgaatccagcgccagcacaagttttatcagaagaaattttagaaaaagcaacttatatt
acgccaaatgaacatgagtgccgcattgtattagatgattttacatcaccaattgaagat
ttattggcgaagtatccaaataaattattgatgacagaaggttctaacggtgttcgtttc
cataatggcacagagattgtacatgttcctagcattgctgttgatgtagtggatacaact
ggagctggtgatacatttaatggtgcgttagcagttgcactttctgaaggagagacactt
caaaaagcaattcgtttcgcgaatattgccggtggtctttctgtaacgaaacttggagca
cagggcggtatgccaacgagagatcgagtacgtgaagtgcaggtgattgttggatga

DBGET integrated database retrieval system