KEGG   Bacillus thuringiensis HD-789: BTF1_02930Help
Entry
BTF1_02930        CDS       T02411                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btn00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BTF1_02930 (glpK)
Enzymes [BR:btn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BTF1_02930 (glpK)
Exosome [BR:btn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTF1_02930 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
590537..592027
Genome map
AA seq 496 aa AA seqDB search
MKKYILSLDQGTTSSRAILFNKKGEIVHSAQKEFTQHFPKPGWVEHNAQEIWGSILAVIA
TCLSEADVKPEQIAGIGITNQRETTVVWDKTTSKPIYNAIVWQSRQTAEICDELKEKGYS
EMVREKTGLLIDAYFSGTKVKWILDNVEGAREKAENGDLLFGTIDSWLVWKLSGGKAHVT
DYSNASRTLMFNIHDLQWDDELLEMLTVPKSMLPEVRPSSEIYGETIDYHFFGQNVPIAG
VAGDQQAALFGQACFGEGMAKNTYGTGCFMLMNTGEKAVASEHGLLTTIAWGIDGKVNYA
LEGSIFVAGSAIQWLRDGMRMFKDASESEVYASRVESTDGVYVVPAFVGLGTPYWDSEVR
GAMFGVTRGTTKEHFIRATLESLAYQTKDVLCAMEADSGIELKTLRVDGGAVKNNFLMKF
QSDILDVPVERPVINETTALGAAYLAGLAVGYWKNQDEIKSQWHMDKRFEPTMEAETSEE
LYAGWKKAIEATKAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatattctttcattagaccaaggaacaacaagctcacgcgcaattcttttc
aataaaaaaggtgaaattgttcattcagctcaaaaagagtttacacaacattttccaaag
ccgggctgggtagagcataatgcacaagaaatttggggatctattttagcagttatcgca
acttgcttaagcgaagcagatgtaaaaccagaacaaatcgcaggtatcggtattacgaac
caacgtgaaacaacggttgtctgggataaaacaactagtaaaccaatttacaacgcaatt
gtatggcaatctcgccaaacagctgaaatttgtgatgagttaaaagaaaaaggttatagc
gaaatggttcgcgaaaaaacaggtcttttaattgatgcatacttctctggtacgaaagta
aaatggattttagataacgttgaaggtgcaagagagaaagcagaaaacggtgatctatta
ttcggaacaattgattcgtggcttgtatggaaactatctggtggtaaagcacacgtaaca
gattattcaaacgcatcacgtacgttaatgtttaatattcacgacttacagtgggatgat
gagcttctagaaatgttaacagtaccaaagagcatgcttccagaagtacgtccatcatct
gaaatttacggagaaacaattgattaccacttcttcggccaaaatgtaccgattgcaggt
gtagctggtgaccaacaagcagcattatttggacaagcttgtttcggtgaaggtatggcg
aaaaatacttacggaactggttgcttcatgttaatgaacacaggtgaaaaagcagtagct
tctgagcacggtctattaacaacaattgcatggggaatagatggtaaagtaaactacgca
ttagaaggaagtattttcgtagcaggttctgcaattcagtggttacgtgacggaatgcgc
atgtttaaagatgcaagtgagagtgaagtgtatgcgagtcgcgttgaatcaactgatggt
gtatacgttgtaccagcattcgttggactaggaacaccttattgggatagtgaagtacgc
ggcgctatgtttggtgtaacacgcggtacgacgaaagagcacttcattcgtgcaacgcta
gaatctttagcttaccaaacgaaagatgtattatgcgcaatggaagcagattcaggtatt
gaactgaaaacattacgcgttgatggcggagcagttaaaaataacttcttaatgaagttc
caaagtgatattttagatgttcctgtagagcgtccagtgattaacgaaacaacggcttta
ggtgcagcatacttagctggtcttgcggttggatattggaaaaaccaagatgaaattaaa
tcacagtggcatatggacaaacgctttgaaccaacgatggaagcggaaacaagcgaagag
ctatatgctggatggaaaaaagcaattgaagcaacaaaagctttcaaataa

DBGET integrated database retrieval system