KEGG   Bacillus thuringiensis HD-789: BTF1_03110Help
Entry
BTF1_03110        CDS       T02411                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
btn00860  Porphyrin and chlorophyll metabolism
btn01100  Metabolic pathways
btn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BTF1_03110
Enzymes [BR:btn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BTF1_03110
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     BTF1_03110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 Pyr_redox_2 HI0933_like Pyr_redox_3 Thi4 DUF4988 DUF4136
Motif
Other DBs
NCBI-ProteinID: AFQ24845
Position
630185..631606
Genome map
AA seq 473 aa AA seqDB search
MRKKVVIVGGGITGLTAMYNLQKNIHEKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERG
PDSFLARKESAARLVKELGLGDELVNNQAGQSFILVNNRLHKMPSGSMMGIPTQITPFLF
SGLFSPIGKLRAGFDLLMPRSKPVSDQSLGQFFRHRLGNEVVENLIEPLLSGIYAGDIDE
MSLMSTFPQMYQIEQKHRSISLGMRTLAPKEEKAKPKKGIFQTVKTGLESIVESLEVKMH
EGTIIKGTRIEKVAKQGDGYTITLSNGKEIEADAIVVATSHKVLPSMFAQYKQFRFFRNI
PATSVANVALAFQKSAIRRDINGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCY
VGRAGDEAVVEQTEEELVQLVLEDLRKTMDITEDPEFTIVSRWKEAMPQYTVGHNERMKK
LTTFMQKELPGIYLAGSSYAGAGLPDCINQGEEAAKRVLSHLEKVIDAELIAQ
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaaaaaagttgtgatcgtcggcggaggcataacgggattaacagcaatgtataac
ttacaaaaaaatattcatgaaaaaaacttgccgattgatacattacttatagaagcatcg
ggtaaacttggcggaaaaattcaaaccgttcgaaaagatggatttacaattgaacgcgga
ccggattctttcttagcacgaaaagaaagtgcagctagattagtgaaagaattaggtctt
ggcgatgaacttgtaaataatcaagccggtcaatcatttatcctcgtaaacaatcggtta
cataaaatgccgagcggatcaatgatgggaattccaacgcaaattacgccgtttctattt
tccgggctgttctccccaattggtaaactaagagctggttttgatctattaatgccgagg
tcaaagccagtatctgaccaatcactcggacaatttttcagacatcgcctcggaaacgaa
gtggttgaaaacttaatagaaccgttactatcgggtatttatgcaggggatattgatgaa
atgagcttaatgtcaacattcccgcaaatgtatcagattgagcagaaacatcgcagtatt
tcactcggtatgcgtacgctcgctccgaaagaagagaaagctaaaccgaaaaaaggaatc
ttccaaacagtgaaaacaggtttagaatctatcgtagaatctctcgaagtaaagatgcat
gaaggtacgataataaagggaactcgcattgaaaaagttgcaaaacagggtgatggttat
acaattactcttagtaatggaaaagaaatagaagcggacgccatcgtagtggcaacttcg
cataaagtattgccgtccatgtttgctcagtacaagcagtttcgtttcttccgtaatatt
ccggccacatccgttgcgaatgtggcacttgctttccaaaagtcagcaatccggcgcgat
attaatggtacaggatttgtcgtatcacgaaatagcgattacacgattacagcatgtacg
tggacgcataaaaaatggccacatacaacgccagaaggaaaaacactccttcgctgttac
gttggacgtgctggtgatgaagcggttgtagaacaaactgaagaagaactcgttcagctc
gtactagaagatttaagaaaaacgatggatattacagaggatccagaatttacaatcgta
agccgctggaaagaagcgatgcctcaatatacagtaggccataatgagcgaatgaaaaag
ctcacaacatttatgcagaaagagttgcctggtatatacttggcaggtagctcctatgct
ggtgctggacttccagattgtattaatcaaggtgaggaagctgcaaagcgtgtattatcc
catttggagaaagtaatagatgctgaattaatcgcacaataa

DBGET integrated database retrieval system