KEGG   Bacillus thuringiensis HD-789: BTF1_03110Help
Entry
BTF1_03110        CDS       T02411                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:btn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
630185..631606
Genome map
AA seq 473 aa AA seqDB search
MRKKVVIVGGGITGLTAMYNLQKNIHEKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERG
PDSFLARKESAARLVKELGLGDELVNNQAGQSFILVNNRLHKMPSGSMMGIPTQITPFLF
SGLFSPIGKLRAGFDLLMPRSKPVSDQSLGQFFRHRLGNEVVENLIEPLLSGIYAGDIDE
MSLMSTFPQMYQIEQKHRSISLGMRTLAPKEEKAKPKKGIFQTVKTGLESIVESLEVKMH
EGTIIKGTRIEKVAKQGDGYTITLSNGKEIEADAIVVATSHKVLPSMFAQYKQFRFFRNI
PATSVANVALAFQKSAIRRDINGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCY
VGRAGDEAVVEQTEEELVQLVLEDLRKTMDITEDPEFTIVSRWKEAMPQYTVGHNERMKK
LTTFMQKELPGIYLAGSSYAGAGLPDCINQGEEAAKRVLSHLEKVIDAELIAQ
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaaaaaagttgtgatcgtcggcggaggcataacgggattaacagcaatgtataac
ttacaaaaaaatattcatgaaaaaaacttgccgattgatacattacttatagaagcatcg
ggtaaacttggcggaaaaattcaaaccgttcgaaaagatggatttacaattgaacgcgga
ccggattctttcttagcacgaaaagaaagtgcagctagattagtgaaagaattaggtctt
ggcgatgaacttgtaaataatcaagccggtcaatcatttatcctcgtaaacaatcggtta
cataaaatgccgagcggatcaatgatgggaattccaacgcaaattacgccgtttctattt
tccgggctgttctccccaattggtaaactaagagctggttttgatctattaatgccgagg
tcaaagccagtatctgaccaatcactcggacaatttttcagacatcgcctcggaaacgaa
gtggttgaaaacttaatagaaccgttactatcgggtatttatgcaggggatattgatgaa
atgagcttaatgtcaacattcccgcaaatgtatcagattgagcagaaacatcgcagtatt
tcactcggtatgcgtacgctcgctccgaaagaagagaaagctaaaccgaaaaaaggaatc
ttccaaacagtgaaaacaggtttagaatctatcgtagaatctctcgaagtaaagatgcat
gaaggtacgataataaagggaactcgcattgaaaaagttgcaaaacagggtgatggttat
acaattactcttagtaatggaaaagaaatagaagcggacgccatcgtagtggcaacttcg
cataaagtattgccgtccatgtttgctcagtacaagcagtttcgtttcttccgtaatatt
ccggccacatccgttgcgaatgtggcacttgctttccaaaagtcagcaatccggcgcgat
attaatggtacaggatttgtcgtatcacgaaatagcgattacacgattacagcatgtacg
tggacgcataaaaaatggccacatacaacgccagaaggaaaaacactccttcgctgttac
gttggacgtgctggtgatgaagcggttgtagaacaaactgaagaagaactcgttcagctc
gtactagaagatttaagaaaaacgatggatattacagaggatccagaatttacaatcgta
agccgctggaaagaagcgatgcctcaatatacagtaggccataatgagcgaatgaaaaag
ctcacaacatttatgcagaaagagttgcctggtatatacttggcaggtagctcctatgct
ggtgctggacttccagattgtattaatcaaggtgaggaagctgcaaagcgtgtattatcc
catttggagaaagtaatagatgctgaattaatcgcacaataa

DBGET integrated database retrieval system