KEGG   Bacillus thuringiensis HD-789: BTF1_03340Help
Entry
BTF1_03340        CDS       T02411                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:btn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BTF1_03340
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTF1_03340
   00630 Glyoxylate and dicarboxylate metabolism
    BTF1_03340
Enzymes [BR:btn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BTF1_03340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
673513..675102
Genome map
AA seq 529 aa AA seqDB search
MSTQTSRVTLVGEMLPAYNEILTPEVLSFLKELHENFNERRIELLQKRVEKQKRIDAGEF
PKFLEETKHIREADWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNS
PTWENAVEGQINLRDAVKGTISHENDKGKEYRLNEKTAVLIVRPRGWHLEEKHMQVDGEN
MSGSLVDFGLYFFHNAKALLAKGSGPYFYLPKMESYLEARLWNDVFVFAQKYIGIPNGTI
KATVLLETIHASFEMDEILYELKDHSAGLNCGRWDYIFSFLKSFRNHNKFLLPDRAQVTM
TAPFMRSYSLKVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHD
GTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREEICVTENDLLEVPVGTITEEGLRMNISV
GIQYIASWFSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNITLELMEELK
EEELAKIEREIGKEAFKKGRFQEATMLFTNLVRNDEFVPFLTLPGYEIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcaaacttcacgggttacactcgttggagaaatgttaccagcgtacaacgaa
atattgacacctgaggtgcttagttttttgaaggaactacatgagaattttaatgagcgc
cgcatagaacttttacaaaaacgtgtagaaaaacaaaagagaattgatgcaggggagttt
ccgaagtttctagaagaaacaaaacacatacgtgaagcggattggacaattgccaagctg
ccaaaagacttagaggatcgccgcgtagagattactggaccggtagatagaaagatggtc
attaacgctttaaattcaggagcgcatctttttatggcggattttgaagattcgaattca
ccaacttgggaaaatgcagtggaaggtcaaatcaacttacgagatgcagtaaagggaacg
atttcacatgaaaatgataaagggaaagaatatagattaaatgagaaaacagctgtactc
attgtacgtccaagaggatggcatttagaggaaaagcatatgcaagttgatggggaaaat
atgtcaggtagcttagtagatttcggcttgtactttttccataatgcgaaagctctttta
gcaaaagggagcggcccatacttttacttaccgaaaatggaaagttatttagaagcgaga
ttatggaatgatgtattcgtatttgctcaaaaatatatcggcattccaaatggaacgatt
aaagcaactgtgttactggaaacgattcacgcttcgtttgaaatggatgaaattttgtat
gagctaaaagatcattctgctggcttaaactgtggaagatgggattatatttttagcttt
ttaaagagtttccgtaatcataataaattcttactaccagatagagcacaagtcacgatg
acagcgccatttatgcgttcgtattctttgaaagtaattcaaacgtgtcaccgccgtaat
gcaccagcaattggaggaatggcggcacaaattccgattaaaaataatccagaagcgaat
gaagcagcttttgaaaaagtgcgtgctgataaggagcgcgaagctttagacggtcatgac
gggacttgggttgctcaccctggacttgtaccggttgcaatggaagtatttaatcacatt
atgaaaacaccaaatcaaattttcagaaaacgtgaagaaatatgtgtaacagaaaacgat
ttactagaggtaccggtgggaacgattacagaagagggccttcgcatgaatattagcgta
ggtattcaatatattgcatcttggttcagcggacggggagcagcacccatttataactta
atggaagatgcggcaactgctgaaatttcaagagcacaagtatggcaatggattcgtcat
gaaggtggaaaactaaatgatggtcgtaatattacgcttgaattaatggaagagctaaaa
gaagaagaattagcaaaaatagaaagagagattggtaaggaagcctttaagaaagggaga
ttccaagaggcgacaatgttgtttacaaatctcgttcgaaatgatgaattcgtaccattt
ttaacattaccaggttatgaaattttataa

DBGET integrated database retrieval system