KEGG   Bacillus thuringiensis HD-789: BTF1_03345Help
Entry
BTF1_03345        CDS       T02411                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:btn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BTF1_03345
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BTF1_03345
Enzymes [BR:btn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BTF1_03345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
675126..676403
Genome map
AA seq 425 aa AA seqDB search
MKNERIEKLQESWELDERWKGITRPYSAEDVIRLRGSIDIEHTLARRGAEKLWTSLHTED
YINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVVKRI
NQTLQRADQIQHMEGSDDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFEDQL
SSEKKCGHLGGKVLLPTQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDIDPVD
KAFITGERTPEGFYRTNAGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFADAIHKEH
PGKLLAYNCSPSFNWKQKLDEKTIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELARGY
KERGMAAYSELQQAEFAAEKHGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGSTEE
AQFTK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaaagaatcgagaaattacaagaaagctgggaattagatgagcgttggaaa
gggatcacacgtccatattcggcagaagatgtaattcgcctgcgcggatcaattgatatt
gaacatacattagcgcgccgcggtgctgagaagctttggacatcgcttcatacagaagac
tatattaacgcacttggcgcattaacaggaaatcaagcgatgcaacaagtaaaagctggg
ttaaaagcgatttacttaagtggttggcaagtggcagctgatgcaaacctttctggacat
atgtatccagaccaaagtttatatccagcgaacagcgtacctgctgtagtgaaacgaatt
aatcaaacacttcaacgtgcggatcaaattcaacatatggaaggaagcgatgatacagac
tatttcgtaccgattgtagcagatgcagaagctggatttggtggacaattaaacgtattc
gaactgatgaaaggtatgattgaagcaggtgcatcaggtgtgcattttgaagatcaatta
tcttcagagaaaaaatgtggccatttaggtggaaaagtactactaccaacgcaaacagcg
gtacgtaatttaatttctgcacgtcttgcagcagatgtaatgggagtgccaacaattatc
gttgcaagaacagatgcagatgcagctgatttaattacgagcgatatcgatcctgttgat
aaagcatttattacaggagaaagaacaccagaaggattttaccgtacgaatgcaggtctt
gatcaagcgattgcgcgcggtttagcgtatgcaccgtatgcagacctcgtttggtgtgaa
acgtcggaaccaaatttagaagatgcaaaacgatttgcggacgcaattcataaggagcat
ccaggaaagttacttgcatataactgttcaccttcattcaactggaaacaaaaactagat
gaaaaaacaattgcgagcttccaaaaggaaatcgcatcttacggttataagttccaattc
gtaacacttgctggattccattcattaaattacggtatgtttgaactagcacgtggctat
aaagagcgcggcatggcagcatactctgaactacaacaagctgaatttgcagcagaaaaa
cacggctactctgcaacacgtcatcaacgcgaagtaggaacaggttactttgatgaagtt
gcacaagtgattacaggcggaacttcatcaacgacagcgttaaaaggatctacagaagaa
gcacagtttacgaaataa

DBGET integrated database retrieval system