KEGG   Bacillus thuringiensis HD-789: BTF1_04005Help
Entry
BTF1_04005        CDS       T02411                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:btn01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:btn00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:btn00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(804841..806079)
Genome map
AA seq 412 aa AA seqDB search
MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGAPVAVSTPAPPAEQAKQETAEAPKAAAPNAEQTTSLQGLPN
TNRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPVAKTEFEK
PVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMSAIMELRKERKDAFEKKHDVRLGF
MSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVPVVRDANQLNFAE
IESEIRNLGMKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQVGILGMHKIQVR
PVAIDNERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKDMLEDPKSLLLEG
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctattaccgaaggaactatttcacaa
tggcttatcaacgtaggcgacaaagttgagaaaggcggcagcgttgttgagcttgaaact
gataaagtcaatgtagaaatcattgcagaagattcaggtattgtatcgaagttactaggc
gaacctggggatacagttgaagttggcgcaactatcgcaattttagatgctaatggagca
ccagttgcagtaagtacacctgcaccacctgctgagcaagcaaaacaagaaacagctgaa
gcaccgaaagctgcggctccaaatgctgaacaaactacgagtctacaaggcttaccaaat
acgaaccgtcctatcgcatcaccagctgctagaaaaatggctcgtgaattaggaatcgac
ttaaacgacgtacgtagcacagatccacttggacgcgtgagaccacatgatgtacaagct
catgctgcagcaccaaaagaagcaccagctgctccagttgcaaaaacagaattcgaaaaa
ccagttgagcgcgtgaaaatgtcccgccgccgtcaaacaattgcaaaacgtcttgtagaa
gttcaacaaacatctgcaatgttaacaacatttaacgaagttgatatgagtgcgatcatg
gaattacgtaaagagcgtaaagacgctttcgagaaaaaacatgatgtacgtcttggcttc
atgtcattcttcacaaaagcagttgttgcagcattaaaacagttcccattattaaatgct
gaaattcaaggtgacgagcttatcatcaaaaaattctatgatatcggtattgcagtagca
gctccagatggattagttgttccagttgtacgcgatgctaaccaattaaacttcgctgaa
atcgaaagtgaaattcgtaatttaggtatgaaagcacgcgataacaaactttcattaaaa
gaactacaaggtggtacatttacaattacaaacgggggtgtattcggttctctaatgtca
acaccaatcctaaatagccctcaagttggtattttaggaatgcataaaatccaagtacgc
ccagttgcaattgataacgagcgtatggaaaaccgcccaatgatgtacattgctttatct
tacgatcaccgtattgttgatggtaaagaagcagttagcttccttgttgctgttaaagat
atgcttgaagatccaaaatcattattattagaaggttga

DBGET integrated database retrieval system