KEGG   Bacillus thuringiensis HD-789: BTF1_04005Help
Entry
BTF1_04005        CDS       T02411                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:btn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BTF1_04005
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTF1_04005
  Amino acid metabolism
   00310 Lysine degradation
    BTF1_04005
Enzymes [BR:btn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BTF1_04005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(804841..806079)
Genome map
AA seq 412 aa AA seqDB search
MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGAPVAVSTPAPPAEQAKQETAEAPKAAAPNAEQTTSLQGLPN
TNRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPVAKTEFEK
PVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMSAIMELRKERKDAFEKKHDVRLGF
MSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVPVVRDANQLNFAE
IESEIRNLGMKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQVGILGMHKIQVR
PVAIDNERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKDMLEDPKSLLLEG
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctattaccgaaggaactatttcacaa
tggcttatcaacgtaggcgacaaagttgagaaaggcggcagcgttgttgagcttgaaact
gataaagtcaatgtagaaatcattgcagaagattcaggtattgtatcgaagttactaggc
gaacctggggatacagttgaagttggcgcaactatcgcaattttagatgctaatggagca
ccagttgcagtaagtacacctgcaccacctgctgagcaagcaaaacaagaaacagctgaa
gcaccgaaagctgcggctccaaatgctgaacaaactacgagtctacaaggcttaccaaat
acgaaccgtcctatcgcatcaccagctgctagaaaaatggctcgtgaattaggaatcgac
ttaaacgacgtacgtagcacagatccacttggacgcgtgagaccacatgatgtacaagct
catgctgcagcaccaaaagaagcaccagctgctccagttgcaaaaacagaattcgaaaaa
ccagttgagcgcgtgaaaatgtcccgccgccgtcaaacaattgcaaaacgtcttgtagaa
gttcaacaaacatctgcaatgttaacaacatttaacgaagttgatatgagtgcgatcatg
gaattacgtaaagagcgtaaagacgctttcgagaaaaaacatgatgtacgtcttggcttc
atgtcattcttcacaaaagcagttgttgcagcattaaaacagttcccattattaaatgct
gaaattcaaggtgacgagcttatcatcaaaaaattctatgatatcggtattgcagtagca
gctccagatggattagttgttccagttgtacgcgatgctaaccaattaaacttcgctgaa
atcgaaagtgaaattcgtaatttaggtatgaaagcacgcgataacaaactttcattaaaa
gaactacaaggtggtacatttacaattacaaacgggggtgtattcggttctctaatgtca
acaccaatcctaaatagccctcaagttggtattttaggaatgcataaaatccaagtacgc
ccagttgcaattgataacgagcgtatggaaaaccgcccaatgatgtacattgctttatct
tacgatcaccgtattgttgatggtaaagaagcagttagcttccttgttgctgttaaagat
atgcttgaagatccaaaatcattattattagaaggttga

DBGET integrated database retrieval system