KEGG   Bacillus thuringiensis HD-789: BTF1_05260Help
Entry
BTF1_05260        CDS       T02411                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:btn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1029747..1030316
Genome map
AA seq 189 aa AA seqDB search
MAKVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHKVFG
EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLARTVDTIARRPQLQ
ERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARS
EILSFIKTK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagttaatttagaacaaattgaacatgcagtacgccttattttagaggcgatt
ggggatgatccaaatcgtgagggagtacttgatacaccaaaacgtgttgcaaaaatgtac
gcagaagtgttctcaggtatgcatgaagatccgaaagagcatttgcataaagtattcgga
gaagatcacgaagagcttgtactagtaaaagatataccattttattcgatgtgtgagcat
catttagttccattctatggagttgctcacgttgcatatattccgcaaggtggaaaggtg
acagggttaagtaaattagctcgtactgtagatacaattgcacgtcgtccacaactgcaa
gaacgtattacatcaacagtagcgaactctattatggaagtattagagcctcatggtgta
atggtagtagtagaagcagaacatatgtgtatgacgatgcgtggtgtgaaaaaaccaggt
gcgaaaacagtaacgacagcagtgcgtggtgtgcttgaaaatgatgctgcagcgcgcagt
gaaattttatcgtttattaaaacgaagtaa

DBGET integrated database retrieval system