KEGG   Bacillus thuringiensis HD-789: BTF1_08470Help
Entry
BTF1_08470        CDS       T02411                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:btn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BTF1_08470
   00670 One carbon pool by folate
    BTF1_08470
Enzymes [BR:btn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BTF1_08470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1646873..1647361
Genome map
AA seq 162 aa AA seqDB search
MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRN
IIVTRNEGYHVEGCEVVHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHYA
FEGDTFFPEMDMTNWKEIFVEKGLTDEQNPYTYYYHVYEKQQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgattgtttcatttatggtcgcaatggacgaaaatagagtaattggtaaagataataat
ttaccttggcgtttaccgagtgaattacaatacgtgaagaaaacaacgatgggtcacccg
cttattatgggaagaaagaactatgaagcgattggtagaccgctgcctggaagacgtaat
attattgtaactcgtaatgaaggatatcacgttgaaggatgtgaagttgttcattctgta
gaagaagtatttgaactatgtaaaaatgaagaagagatttttatttttggcggggcgcaa
atttatgatctctttttaccttatgtagacaaattgtatataacaaaaatccattatgca
tttgaaggagatacattcttcccagaaatggatatgacaaattggaaagagatttttgtg
gaaaaaggtttaacggatgaacaaaacccgtatacgtattattaccatgtatatgagaaa
caacaataa

DBGET integrated database retrieval system