KEGG   Bacillus thuringiensis HD-789: BTF1_08610Help
Entry
BTF1_08610        CDS       T02411                                 

Definition
ethanol-active dehydrogenase/acetaldehyde-active reductase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BTF1_08610
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTF1_08610
  Lipid metabolism
   00071 Fatty acid degradation
    BTF1_08610
  Amino acid metabolism
   00350 Tyrosine metabolism
    BTF1_08610
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTF1_08610
   00626 Naphthalene degradation
    BTF1_08610
Enzymes [BR:btn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BTF1_08610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1671967..1673004
Genome map
AA seq 345 aa AA seqDB search
MKAVVVNKNSKANIEVVEKELRPLRSGEALVDVEYCGVCHTDLHVANHDFGNTDGRILGH
EGVGIVTKIADDVNSLKIGDRVSIAWMFQSCGRCEYCVTGRETFCREVKNAGYSVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSDIKPGQPIVIYGCGGLGNLAI
QYAKNVFGAKVIAVDINDDKLALAKEVGADMTINPISQGPADKIVQEELGGAYAAVVTAV
SKVAFNSAVDAVRACGKVVAVGLPVETMDLNIPRLVLDGIEVVGSLVGTRKDLEEAFMFG
AEGKVVPVVQTCSLDKVQNVFEEMEQGRIQGRMVIDFKKHNCDCK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtagtggttaataaaaacagcaaagcaaacatcgaagtggttgaaaaagaa
ttacgtccgttacgctcaggtgaagcgttagtagatgtagagtattgtggagtttgccac
actgatttacacgttgcgaatcatgattttggtaacactgatggccgtattcttggtcat
gagggtgtaggtattgttacgaaaatagctgatgatgttaattcgctaaagataggtgac
cgtgtaagtattgcatggatgttccaatcttgtggacgttgtgaatattgcgtaactggt
agagaaacattttgccgtgaagttaaaaacgcaggttattcagtagatggtggtatggct
gaacaatgtatcgttacagctgattatgcggtaaaagtaccagaaggattagatcctgct
caagcatcatcaattacatgtgctggtgtaactacatataaagctattaaagtatcagat
attaaacctggtcaacctattgtaatctatggctgcggtggattaggtaacttagctatc
caatatgctaaaaatgtatttggtgcaaaggtaatcgcagtagacattaatgacgacaaa
ttagccttagcgaaagaagttggtgctgatatgactatcaatccaatttctcaaggtcct
gctgataaaattgttcaagaggagcttggtggcgcttatgctgcggtagtaacagcagtc
tctaaagtagcctttaactcagcagttgatgcagtacgtgcttgcggtaaagtagttgca
gtagggctaccagtagaaacaatggacttaaacatcccgcgacttgtactggatggaatt
gaagtagttggttctctagttggtactcgtaaagatttggaagaggcgtttatgtttggg
gcagaaggaaaagtagtgccggttgttcaaacttgttcgctagataaagtacaaaatgta
ttcgaagaaatggaacaaggtagaattcaagggcgtatggtaattgattttaaaaaacat
aattgtgattgcaaataa

DBGET integrated database retrieval system