KEGG   Bacillus thuringiensis HD-789: BTF1_08610Help
Entry
BTF1_08610        CDS       T02411                                 

Definition
(GenBank) ethanol-active dehydrogenase/acetaldehyde-active reductase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
btn00010  Glycolysis / Gluconeogenesis
btn00071  Fatty acid degradation
btn00350  Tyrosine metabolism
btn00625  Chloroalkane and chloroalkene degradation
btn00626  Naphthalene degradation
btn01100  Metabolic pathways
btn01110  Biosynthesis of secondary metabolites
btn01120  Microbial metabolism in diverse environments
btn01130  Biosynthesis of antibiotics
btn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTF1_08610
  Lipid metabolism
   00071 Fatty acid degradation
    BTF1_08610
  Amino acid metabolism
   00350 Tyrosine metabolism
    BTF1_08610
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTF1_08610
   00626 Naphthalene degradation
    BTF1_08610
Enzymes [BR:btn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BTF1_08610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 2-Hacid_dh_C TrkA_N Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: AFQ25931
Position
1671967..1673004
Genome map
AA seq 345 aa AA seqDB search
MKAVVVNKNSKANIEVVEKELRPLRSGEALVDVEYCGVCHTDLHVANHDFGNTDGRILGH
EGVGIVTKIADDVNSLKIGDRVSIAWMFQSCGRCEYCVTGRETFCREVKNAGYSVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSDIKPGQPIVIYGCGGLGNLAI
QYAKNVFGAKVIAVDINDDKLALAKEVGADMTINPISQGPADKIVQEELGGAYAAVVTAV
SKVAFNSAVDAVRACGKVVAVGLPVETMDLNIPRLVLDGIEVVGSLVGTRKDLEEAFMFG
AEGKVVPVVQTCSLDKVQNVFEEMEQGRIQGRMVIDFKKHNCDCK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtagtggttaataaaaacagcaaagcaaacatcgaagtggttgaaaaagaa
ttacgtccgttacgctcaggtgaagcgttagtagatgtagagtattgtggagtttgccac
actgatttacacgttgcgaatcatgattttggtaacactgatggccgtattcttggtcat
gagggtgtaggtattgttacgaaaatagctgatgatgttaattcgctaaagataggtgac
cgtgtaagtattgcatggatgttccaatcttgtggacgttgtgaatattgcgtaactggt
agagaaacattttgccgtgaagttaaaaacgcaggttattcagtagatggtggtatggct
gaacaatgtatcgttacagctgattatgcggtaaaagtaccagaaggattagatcctgct
caagcatcatcaattacatgtgctggtgtaactacatataaagctattaaagtatcagat
attaaacctggtcaacctattgtaatctatggctgcggtggattaggtaacttagctatc
caatatgctaaaaatgtatttggtgcaaaggtaatcgcagtagacattaatgacgacaaa
ttagccttagcgaaagaagttggtgctgatatgactatcaatccaatttctcaaggtcct
gctgataaaattgttcaagaggagcttggtggcgcttatgctgcggtagtaacagcagtc
tctaaagtagcctttaactcagcagttgatgcagtacgtgcttgcggtaaagtagttgca
gtagggctaccagtagaaacaatggacttaaacatcccgcgacttgtactggatggaatt
gaagtagttggttctctagttggtactcgtaaagatttggaagaggcgtttatgtttggg
gcagaaggaaaagtagtgccggttgttcaaacttgttcgctagataaagtacaaaatgta
ttcgaagaaatggaacaaggtagaattcaagggcgtatggtaattgattttaaaaaacat
aattgtgattgcaaataa

DBGET integrated database retrieval system