KEGG   Bacillus thuringiensis HD-789: BTF1_13525Help
Entry
BTF1_13525        CDS       T02411                                 

Definition
bifunctional P-450:NADPH-P450 reductase 1
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btn00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BTF1_13525
  Amino acid metabolism
   00380 Tryptophan metabolism
    BTF1_13525
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BTF1_13525
Enzymes [BR:btn01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BTF1_13525
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BTF1_13525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2651789..2654986)
Genome map
AA seq 1065 aa AA seqDB search
MEKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKLAEEYGPIFRIQTLSDAIIVVSGHEL
VAEVCDETRFDKSIEGALAKVRAFAGDGLFTSETHEPNWKKAHNILMPTFSQRAMKDYHA
MMVDLAVQLVQKWARLNPNEDVDVPEDMTRLTLDTIGLCGFNYRFNSFYRETPHPFITSM
SRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSSGDQEENDLLSR
MLNVQDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLKKAYEEVDR
ILTDPTPTYQQVMKLKYIRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIKKGEDRISV
LIPQLHRDKDAWGDNVEEFQPERFEELDKVPHHAYKPFGNGQRACIGMQFALHEATLVMG
MLLQHFELIDYQNYQLDVKQTLTLKPGDFKIRILPRKQTISHPTVLAPTEDKLKNHEIKQ
HVQKTPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVQTEVVALNDRIGSLPKE
GAVLIVTSSYNGKPPSNAGQFVQWLEELKPDELKGVQYAVFGCGDHNWASTYQRIPRYID
EQMAQKGATRFSKRGEADASGDFEEQLEQWKQGMWSDAMKAFGLEFNKNMEKERSTLSLQ
FVSRLGGSPLARTYEAVYATILENRELQSSSSDRSTRHIEVSLPEGATYQEGDHLGVLPI
NSEKNVNRILKRFGLNGKDQVILSASGRSINHIPLDSPVSLLDLLSYSVEVQEAATRAQI
REMVTFTACPPHKKELEALLEEGVYHEQILKKRISMLDLLEKYKACEIRFERFLELLPAL
KPRYYSISSSPLVAQNRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNKDEIICFIRTP
QSNFELPKDPETPIIMVGPGTGVAPFRGFLQARRVQKQKGINLGQAHLYFGCRHPEKDYL
YRTELENDERDGLISLHTAFSRLEGHPKTYVQHLIKQDSINLISLLDNGAHLYICGDGSK
MAPDVEDTLCQAYQEIHEVSEQEARNWLDRVQDEGRYGKDVWAGI
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaagtatctgccattccccagccgaaaacatatggaccgctgggtaatctc
ccattaatcgataaagataaaccgactctatcgtttattaagctggcggaagagtatggt
cccatttttcgaattcaaactttaagtgatgccataattgtcgtttctggacatgaactg
gtagcagaagtttgtgacgaaacgcggttcgataaaagcatagagggtgctttggcaaag
gttcgtgcctttgctggagacggattatttactagcgagactcacgagcctaactggaaa
aaagctcataatattttgatgcctacatttagccaacgggcaatgaaagattaccatgcc
atgatggtcgatcttgctgtacaactcgttcaaaaatgggcacggcttaatccgaatgaa
gacgtagatgttccggaggatatgactcgccttacgttagatacaattggtctatgtggt
tttaattaccgatttaatagcttttatcgtgagacccctcatccttttatcactagcatg
agccgtgctctagatgaggcaatgcaccaattgcagcggctggatatagaagacaaactc
atgtggagaacgaaacgtcaatttcagcatgatatccaatctatgttttctttagtagat
aatattattgctgaacgtaaaagtagtggagatcaggaagaaaatgatttactttcccgt
atgttaaatgtacaggatccggaaactggtgaaaaattagatgatgaaaacattcgtttc
caaattatcacttttttaatagctgggcatgagacaacaagtggattgttatcttttgca
atttactttttattaaagaatccggataagttaaaaaaagcctatgaagaagtagaccgt
attttgacagatcctactccaacataccaacaagttatgaaactgaagtatatacggatg
attttaaatgaatcgctacgtctatggcctaccgctccagcattcagtctctatgcaaaa
gaagatacagtgattggcgggaaatacccaattaagaaaggagaagatcgtatttctgtt
cttattccacagctgcatagggataaagatgcatggggagacaatgtggaagaattccaa
cctgaacgatttgaagagctggataaggttcctcatcatgcttataagccatttggaaat
ggccagagagcatgtatcggtatgcaatttgcacttcatgaagccactcttgtaatggga
atgcttcttcaacattttgaattaatcgattatcaaaactatcagctggacgtaaaacaa
acattaacgctaaagcccggtgattttaagattaggattctaccccgaaaacaaactatt
agtcatcctactgttcttgcacctacagaggacaagctgaaaaaccatgaaattaagcag
cacgttcagaagacaccttctattattggggctgataatctttcacttcttgttctgtac
ggctcggatacaggtgtagcagaaggtattgcaagagaattagcagatacagctagttta
gaaggggttcaaacggaagtggtagctcttaacgatcgaattggaagtctaccgaaagaa
ggagcggttcttattgtaacttcttcttataatggaaaaccgccaagtaatgcaggacag
tttgtgcaatggttggaggaactaaaaccagatgagctaaaaggtgttcaatacgcagtt
tttggttgtggagatcataattgggctagtacctatcaacggattccaagatacattgat
gagcagatggctcaaaaaggagcaacaaggttttctaaacgcggagaagcagatgcaagt
ggtgattttgaggaacagctcgagcaatggaaacaaggcatgtggtctgatgcgatgaag
gcatttggattggaatttaacaaaaatatggagaaagagcgtagtactttgagtctgcaa
tttgtcagtcgtcttggaggatctcctcttgcacgaacatatgaagcagtttatgcaact
atactagaaaatcgtgaactccaatcatccagcagcgatagaagtacacgacatatcgag
gtatccttgccagaaggcgctacatatcaagaaggagaccaccttggagtgctgccaatt
aatagcgagaagaatgttaatcgaattttaaaacgctttggattaaacggaaaggatcaa
gtcatactgagtgcaagtggacgaagtataaatcacatacctttagacagtcctgttagt
ttattggaccttcttagttatagtgtcgaagttcaagaagcagccactcgtgcacaaata
cgggaaatggtaacattcacagcatgccctcctcataaaaaagaattggaagcattatta
gaagaaggggtctatcatgaacaaatactaaagaaacgtatttcaatgttggatcttctt
gaaaagtataaggcttgtgaaatccgatttgaacgctttttagaactgcttcctgcgctc
aaaccgcgttactattctatttcaagctctccacttgttgcacagaatcgtctgagcatt
acggtcggtgttgttaatgcgcctgcatggagtggagaagggacatatgaaggagtcgct
tctaattatttagctcagcgtcataataaagatgagattatttgtttcattcgaacgcca
caatcaaactttgaattacctaaagatccagaaacaccaattattatggttgggccaggt
actggagttgcaccattccgtggattcttgcaagcgcgtcgtgttcaaaagcaaaaaggt
attaatttaggacaagcgcatctatattttggttgtcgtcatcctgaaaaagattatctc
tatcgtacagagctagaaaatgatgaaagagatggattaatctctttacacacagctttt
tctcgtctagagggacatcccaaaacatatgtacagcatttaataaaacaagatagtatc
aatttaatttcgttattagataatggagctcatctttatatatgtggtgatggcagtaaa
atggctccggatgtagaagataccctttgtcaagcatatcaagaaattcatgaagtcagt
gaacaagaagcaaggaattggttggatcgtgtgcaagatgaagggcgatatggaaaagat
gtttgggctggtatatga

DBGET integrated database retrieval system