KEGG   Bacillus thuringiensis HD-789: BTF1_13525Help
Entry
BTF1_13525        CDS       T02411                                 

Definition
bifunctional P-450:NADPH-P450 reductase 1
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:btn00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:btn00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:btn00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2651789..2654986)
Genome map
AA seq 1065 aa AA seqDB search
MEKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKLAEEYGPIFRIQTLSDAIIVVSGHEL
VAEVCDETRFDKSIEGALAKVRAFAGDGLFTSETHEPNWKKAHNILMPTFSQRAMKDYHA
MMVDLAVQLVQKWARLNPNEDVDVPEDMTRLTLDTIGLCGFNYRFNSFYRETPHPFITSM
SRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSSGDQEENDLLSR
MLNVQDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLKKAYEEVDR
ILTDPTPTYQQVMKLKYIRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIKKGEDRISV
LIPQLHRDKDAWGDNVEEFQPERFEELDKVPHHAYKPFGNGQRACIGMQFALHEATLVMG
MLLQHFELIDYQNYQLDVKQTLTLKPGDFKIRILPRKQTISHPTVLAPTEDKLKNHEIKQ
HVQKTPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVQTEVVALNDRIGSLPKE
GAVLIVTSSYNGKPPSNAGQFVQWLEELKPDELKGVQYAVFGCGDHNWASTYQRIPRYID
EQMAQKGATRFSKRGEADASGDFEEQLEQWKQGMWSDAMKAFGLEFNKNMEKERSTLSLQ
FVSRLGGSPLARTYEAVYATILENRELQSSSSDRSTRHIEVSLPEGATYQEGDHLGVLPI
NSEKNVNRILKRFGLNGKDQVILSASGRSINHIPLDSPVSLLDLLSYSVEVQEAATRAQI
REMVTFTACPPHKKELEALLEEGVYHEQILKKRISMLDLLEKYKACEIRFERFLELLPAL
KPRYYSISSSPLVAQNRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNKDEIICFIRTP
QSNFELPKDPETPIIMVGPGTGVAPFRGFLQARRVQKQKGINLGQAHLYFGCRHPEKDYL
YRTELENDERDGLISLHTAFSRLEGHPKTYVQHLIKQDSINLISLLDNGAHLYICGDGSK
MAPDVEDTLCQAYQEIHEVSEQEARNWLDRVQDEGRYGKDVWAGI
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaagtatctgccattccccagccgaaaacatatggaccgctgggtaatctc
ccattaatcgataaagataaaccgactctatcgtttattaagctggcggaagagtatggt
cccatttttcgaattcaaactttaagtgatgccataattgtcgtttctggacatgaactg
gtagcagaagtttgtgacgaaacgcggttcgataaaagcatagagggtgctttggcaaag
gttcgtgcctttgctggagacggattatttactagcgagactcacgagcctaactggaaa
aaagctcataatattttgatgcctacatttagccaacgggcaatgaaagattaccatgcc
atgatggtcgatcttgctgtacaactcgttcaaaaatgggcacggcttaatccgaatgaa
gacgtagatgttccggaggatatgactcgccttacgttagatacaattggtctatgtggt
tttaattaccgatttaatagcttttatcgtgagacccctcatccttttatcactagcatg
agccgtgctctagatgaggcaatgcaccaattgcagcggctggatatagaagacaaactc
atgtggagaacgaaacgtcaatttcagcatgatatccaatctatgttttctttagtagat
aatattattgctgaacgtaaaagtagtggagatcaggaagaaaatgatttactttcccgt
atgttaaatgtacaggatccggaaactggtgaaaaattagatgatgaaaacattcgtttc
caaattatcacttttttaatagctgggcatgagacaacaagtggattgttatcttttgca
atttactttttattaaagaatccggataagttaaaaaaagcctatgaagaagtagaccgt
attttgacagatcctactccaacataccaacaagttatgaaactgaagtatatacggatg
attttaaatgaatcgctacgtctatggcctaccgctccagcattcagtctctatgcaaaa
gaagatacagtgattggcgggaaatacccaattaagaaaggagaagatcgtatttctgtt
cttattccacagctgcatagggataaagatgcatggggagacaatgtggaagaattccaa
cctgaacgatttgaagagctggataaggttcctcatcatgcttataagccatttggaaat
ggccagagagcatgtatcggtatgcaatttgcacttcatgaagccactcttgtaatggga
atgcttcttcaacattttgaattaatcgattatcaaaactatcagctggacgtaaaacaa
acattaacgctaaagcccggtgattttaagattaggattctaccccgaaaacaaactatt
agtcatcctactgttcttgcacctacagaggacaagctgaaaaaccatgaaattaagcag
cacgttcagaagacaccttctattattggggctgataatctttcacttcttgttctgtac
ggctcggatacaggtgtagcagaaggtattgcaagagaattagcagatacagctagttta
gaaggggttcaaacggaagtggtagctcttaacgatcgaattggaagtctaccgaaagaa
ggagcggttcttattgtaacttcttcttataatggaaaaccgccaagtaatgcaggacag
tttgtgcaatggttggaggaactaaaaccagatgagctaaaaggtgttcaatacgcagtt
tttggttgtggagatcataattgggctagtacctatcaacggattccaagatacattgat
gagcagatggctcaaaaaggagcaacaaggttttctaaacgcggagaagcagatgcaagt
ggtgattttgaggaacagctcgagcaatggaaacaaggcatgtggtctgatgcgatgaag
gcatttggattggaatttaacaaaaatatggagaaagagcgtagtactttgagtctgcaa
tttgtcagtcgtcttggaggatctcctcttgcacgaacatatgaagcagtttatgcaact
atactagaaaatcgtgaactccaatcatccagcagcgatagaagtacacgacatatcgag
gtatccttgccagaaggcgctacatatcaagaaggagaccaccttggagtgctgccaatt
aatagcgagaagaatgttaatcgaattttaaaacgctttggattaaacggaaaggatcaa
gtcatactgagtgcaagtggacgaagtataaatcacatacctttagacagtcctgttagt
ttattggaccttcttagttatagtgtcgaagttcaagaagcagccactcgtgcacaaata
cgggaaatggtaacattcacagcatgccctcctcataaaaaagaattggaagcattatta
gaagaaggggtctatcatgaacaaatactaaagaaacgtatttcaatgttggatcttctt
gaaaagtataaggcttgtgaaatccgatttgaacgctttttagaactgcttcctgcgctc
aaaccgcgttactattctatttcaagctctccacttgttgcacagaatcgtctgagcatt
acggtcggtgttgttaatgcgcctgcatggagtggagaagggacatatgaaggagtcgct
tctaattatttagctcagcgtcataataaagatgagattatttgtttcattcgaacgcca
caatcaaactttgaattacctaaagatccagaaacaccaattattatggttgggccaggt
actggagttgcaccattccgtggattcttgcaagcgcgtcgtgttcaaaagcaaaaaggt
attaatttaggacaagcgcatctatattttggttgtcgtcatcctgaaaaagattatctc
tatcgtacagagctagaaaatgatgaaagagatggattaatctctttacacacagctttt
tctcgtctagagggacatcccaaaacatatgtacagcatttaataaaacaagatagtatc
aatttaatttcgttattagataatggagctcatctttatatatgtggtgatggcagtaaa
atggctccggatgtagaagataccctttgtcaagcatatcaagaaattcatgaagtcagt
gaacaagaagcaaggaattggttggatcgtgtgcaagatgaagggcgatatggaaaagat
gtttgggctggtatatga

DBGET integrated database retrieval system