KEGG   Bacillus thuringiensis HD-789: BTF1_17470Help
Entry
BTF1_17470        CDS       T02411                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
btn00020  Citrate cycle (TCA cycle)
btn00640  Propanoate metabolism
btn00660  C5-Branched dibasic acid metabolism
btn01100  Metabolic pathways
btn01110  Biosynthesis of secondary metabolites
btn01120  Microbial metabolism in diverse environments
btn01130  Biosynthesis of antibiotics
btn01200  Carbon metabolism
Module
btn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:btn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTF1_17470 (sucC)
   00640 Propanoate metabolism
    BTF1_17470 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BTF1_17470 (sucC)
Enzymes [BR:btn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BTF1_17470 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AFQ27663
Position
complement(3403778..3404938)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTDVCVVKAQIHAGGRGKAGGV
KVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQ
VVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKF
MMGLYRAFIEKDCSIAEINPLVTTGEGKVMALDAKLNFDSNALYRHKDILELRDLDEEDS
KEIEASKYDLNYIPLDGNIGCMVNGAGLAMATMDIIKHYHGDPANFLDVGGGATAEKVTE
AFKIILSDKNVKGIFVNIFGGIMKCDVIAEGVIEATKQVGLELPLVVRLEGTNVELGKKI
LNESGLNIVAAESMADGAQKIVSLVG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccaaggtaaggcagtccttagaagctatggggttagcgttccg
aacgggaaggttgcatttacagtagaagaagctgtagaagcagcgaaagaactaggaaca
gatgtatgtgtagtgaaagcacaaattcacgctggtggacgcggcaaagctggcggagta
aaagttgcaaaaaatttagatgaagttcgtacatatgcagaaagcattttaggaactaca
cttgtgacacatcaaacaggtcctgaaggtaaggaagtaaaacgcttacttatcgaagaa
ggttgcgatattaaaaaagaatattatgtaggtctagttttagatcgtgcaacttctcaa
gttgttttaatggcgtctgaagaaggcggaacagaaattgaagaagtagcagaaaaaaca
cctgaaaaaatctttaaagaatatattgatccagcagtaggcttacaaggtttccaagca
cgccgaattgcatttaacatcaatattccaaaagagcttgtaggacaagctgtgaagttt
atgatgggcttataccgtgcgtttatcgaaaaagattgctctatcgctgagattaaccca
cttgttacaacaggtgaaggtaaagttatggcattagatgcaaaattaaactttgattct
aatgcgttatatcgccataaagacattttagagcttcgtgatcttgatgaagaggattca
aaagaaattgaagcttcaaaatacgatttaaactacattcctttagatggaaatatcggt
tgtatggttaatggtgcaggtttagcgatggctacaatggatatcattaaacattaccac
ggtgacccagctaacttcttagatgttggtggcggtgcaactgctgaaaaagttacagaa
gcattcaaaattatcctttctgacaaaaatgtaaaaggtatcttcgttaacatttttggt
ggtattatgaagtgtgatgttattgcagaaggtgttattgaagcaacgaaacaagtaggt
cttgagttacctttagttgtacgtcttgaaggtacaaacgtagaactaggtaagaaaatt
ttaaatgagtctggcttaaatattgttgcagcagaatctatggcagacggtgcacaaaaa
attgtttcactagtgggctaa

DBGET integrated database retrieval system