KEGG   Bacillus thuringiensis HD-789: BTF1_18510Help
Entry
BTF1_18510        CDS       T02411                                 

Definition
5-methylthio-3-oxo-1-penten-1,2-diol dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:btn00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BTF1_18510
Enzymes [BR:btn01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     BTF1_18510
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     BTF1_18510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3602048..3602560
Genome map
AA seq 170 aa AA seqDB search
MAQIRIHEVNTRIENEVEVSKFLQEEGVLYEKWNISKLPTHLNENYSLTDENKAEILAVF
SKEIADVSASRGYKAHDVISLSNSTPNLDELLINFQKEHHHTDDEVRFIVSGHGIFAIEG
KDGKFFDVELEPGDLISVPENARHYFTLQDDRQVVAIRIFVTTEGWVPIY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaattcgtattcatgaagtaaatactcgtattgaaaatgaagtggaagtatct
aaatttctacaagaggaaggcgttttatatgagaaatggaatatttctaaacttcctact
catttaaatgaaaattattctttaacagatgaaaacaaagctgaaatattagctgttttt
tcaaaagaaatcgctgatgtttcagcaagtcgaggttataaagcacatgatgtaatttca
ctttcaaatagcacacctaaccttgacgaattattaattaatttccaaaaagagcatcat
catacagacgacgaagtccgctttatcgtcagtggtcatggcattttcgctattgaaggc
aaagatgggaaattctttgatgttgaacttgagccaggcgatctcatatctgttcctgaa
aatgcaagacattattttaccttgcaagatgatcgtcaagttgtagctattcgtattttt
gtgacaactgaaggctgggttccaatctattaa

DBGET integrated database retrieval system