KEGG   Bacillus thuringiensis HD-789: BTF1_20340Help
Entry
BTF1_20340        CDS       T02411                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:btn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BTF1_20340
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BTF1_20340
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BTF1_20340
Enzymes [BR:btn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BTF1_20340
Exosome [BR:btn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTF1_20340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3922915..3924300)
Genome map
AA seq 461 aa AA seqDB search
MKKFVKKAWPFAVVASLAVTSVATWNFTRSSEVNADENGSNAKIKNVIVLIGDGMGPSYM
TAHRYMKDNPKTFEMESTEFDKHLVGTQKTYPEDEHENITDSASAATAMSAGIKTYNAAI
AVDNDKAEVKTVLEQAKEKGKSTGLVATSEITHATPAAFGAHDISRKNMDAIANDYFDEK
IKGKHKVDVMLGGGVKNFVRKDRNLTEEFKKSGYSYVTDRDQLLNDKNDQILGLFAPGGL
DKMIDRNDKTPSLEEMTNAAIERLNKNKNGFFLMVEGSQIDWAGHDNDIVGAMSEMEDFE
KAFKAAIEFAKKDKNTLVVATADHATGGLSLGANGEYNFKVDPIKAAKRTPDFMANEIAK
GANVEETLKKYIDLQLTPEEIQAVNDIAPSKDVTKIDNAIEDIFNKRSVTGWTTGGHTGE
DVNVYAFGPGKYLFSGVQENTNIAKRVFDIVGGGDPNKGRR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagtttgtgaaaaaagcatggccatttgcagttgtggcatcattagcagttact
tcggtagcaacatggaattttactcgttctagtgaggttaatgcagatgagaacggaagc
aatgcaaagattaaaaatgttatcgtattaattggggatggtatgggcccttcatatatg
acggctcaccggtatatgaaagataatccaaaaacttttgaaatggaatctacagaattt
gataagcatcttgtaggaacacaaaaaacatacccagaagatgaacatgaaaatattaca
gactctgcatcagcagcaacagctatgtcagcagggattaaaacatataatgctgcaatt
gcagttgataatgataaagcggaagtgaaaacggttcttgagcaagcgaaagaaaaaggg
aaatcaacgggacttgttgcaacttctgaaattacacatgcaacaccagctgctttcggt
gcgcatgacattagccgtaaaaatatggacgcaattgcaaatgattattttgatgagaaa
attaaagggaagcataaagtagatgttatgcttggcggcggcgtaaagaactttgttaga
aaagatcgtaatcttacagaagagtttaagaaatctggttatagctatgtaacggatcga
gatcaattgttaaatgataaaaatgatcaaattcttggtttatttgcaccaggtggatta
gataaaatgattgaccgtaatgataaaacaccttcattagaagaaatgactaatgcagca
attgagcgtttgaacaaaaataaaaatggtttcttcttaatggtggaaggaagtcaaatc
gactgggctggacatgataatgatatcgttggtgcaatgagtgaaatggaagacttcgaa
aaagctttcaaagcagcgattgagtttgcgaaaaaagataaaaatacgttagttgttgca
acggcagaccacgctacaggtggattatctttaggtgccaatggcgagtataactttaaa
gtagatccaattaaagctgcaaaacgcacaccagactttatggcaaatgagattgcaaaa
ggtgcaaatgtagaagaaacattaaaaaaatatattgatttacaattaactccagaagaa
attcaagctgtaaatgatatagctccgtcaaaagatgtaacaaagattgataatgcaatt
gaagatattttcaataaacgctcggttacaggctggacaacaggcgggcatacaggggaa
gatgtaaacgtgtatgcatttggtccaggtaaatacttattctctggcgttcaagagaat
acaaatatagcgaaacgtgtctttgatattgttggcggcggcgatccgaataaaggaaga
cgataa

DBGET integrated database retrieval system