KEGG   Bacillus thuringiensis HD-789: BTF1_20460Help
Entry
BTF1_20460        CDS       T02411                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
btn00010  Glycolysis / Gluconeogenesis
btn00071  Fatty acid degradation
btn00350  Tyrosine metabolism
btn00620  Pyruvate metabolism
btn00625  Chloroalkane and chloroalkene degradation
btn00626  Naphthalene degradation
btn00650  Butanoate metabolism
btn01100  Metabolic pathways
btn01110  Biosynthesis of secondary metabolites
btn01120  Microbial metabolism in diverse environments
btn01130  Biosynthesis of antibiotics
btn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTF1_20460
   00620 Pyruvate metabolism
    BTF1_20460
   00650 Butanoate metabolism
    BTF1_20460
  Lipid metabolism
   00071 Fatty acid degradation
    BTF1_20460
  Amino acid metabolism
   00350 Tyrosine metabolism
    BTF1_20460
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTF1_20460
   00626 Naphthalene degradation
    BTF1_20460
Enzymes [BR:btn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BTF1_20460
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BTF1_20460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AFQ28261
Position
complement(3943851..3946454)
Genome map
AA seq 867 aa AA seqDB search
MVVKEKVVNEMQEVKEMIDTLVNNGQQALQALESFTQEQIDNIVHEMALAGVDQHMPLAK
LAVEETGRGVYEDKCIKNIFATEYIWHSIKQDKTVGIIHEDPHEEIIEIAEPVGVVAGVT
PVTNPTSTTMFKALIAIKTRNPIIFAFHPSAQNCSVAAAKTVYDAAMKTGAPKHCIQWIE
RPSVEATKQLMNHDGVALVLATGGAGMVKSAYSTGKPALGVGPGNVPCYIEKSAHVKRAV
NDLILSKTFDNGMICASEQAIIVDKEIYDDVKTEMIENNCYFVTEEERKKLEKLVINENT
CAVNSDIVGKSAQYIAELVGITVPEHTKMLVAEIQGIGAAYPLSREKLSPVLACVKANSL
EKGFTYCEEMLNLGGLGHSAVIHSTNKEVQKQFGLRMKACRLIVNAPSSQGGIGDIYNGF
IPSLTLGCGSYGKNSVSQNVTATHLLNIKRLANRKKNMQWFKLPPKIYFEKHATAYLANM
PNISRAFIVTDPGMVEHGYVDTVTHYLNKHANDVKIEVFFEIEPDPSDETVFKGAEMMRS
FKPDVIIALGGGSAMDAAKGMWLFYEHPETTFYGIKQKFLDIRKRTCKYPELGNKAQFVA
IPTTSGTGSEVTPFAVITDKKNNIKYPLADYELTPDVAIVDPQFVMTVPPHVTADTGMDV
LTHAIEAYVSVMANDYTDGLALKAIDLVFKYLPRAYKDGNDEEAREKMHNASAIAGMAFA
NAFLGINHSLAHKIGPEFHIPHGRANAILMPHVVRYNAIKPRKHALFPKYEHFVADERYA
HIARMLGLPASSVAEGVESLVKAITELGKSLNINMSIAGQGVDKEQFEEVVGVLAERAFE
DQCTTANPKLPLISELKEIYMEAYKGE
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggtagtcaaagagaaagttgtaaatgaaatgcaagaggtaaaagagatgattgatacg
ttagtaaataacggtcaacaagctttacaagcattagaaagttttacacaagagcagatt
gacaacattgttcatgaaatggcattagcaggtgttgatcaacatatgccacttgcaaaa
ttggctgttgaagaaacaggccgtggtgtctatgaagacaaatgcattaaaaatattttt
gccactgaatatatttggcatagtataaagcaagataaaacggtaggaattattcacgaa
gatcctcatgaagaaataatagaaattgcagaacctgtcggtgtagtagctggggtaaca
ccagtaacgaatccaacgtcgacaacaatgtttaaagcgttgattgcgataaaaacgaga
aatccaattattttcgcatttcatccttctgcacaaaattgttcggtggcagcagcgaaa
accgtatatgatgcagcaatgaaaactggtgcaccaaaacattgtattcaatggattgaa
agaccgtctgtcgaagcgacgaaacaattaatgaaccatgatggtgtggcactcgttcta
gcaactggaggcgctggtatggtgaaatcagcttactctactggaaaaccagcgctaggt
gtaggtcctggtaatgtaccgtgttatatagaaaaatcagcacatgtaaaacgagctgtt
aatgatttaattttatcgaaaacatttgataacggtatgatttgtgcatcggaacaagca
atcattgtcgataaagaaatctatgatgatgttaaaacagaaatgatcgaaaacaattgt
tactttgtaacagaagaagaaagaaaaaaattagaaaagctcgttataaatgaaaataca
tgtgcagtaaatagtgatattgtaggaaaatcagcacagtatattgccgaattagttggg
attactgttcctgaacatacaaaaatgcttgtagctgaaattcaaggtatcggagcagca
tacccgttatctcgtgagaaactgagcccagtattagcctgtgtgaaggcgaattcatta
gaaaaaggatttacatattgcgaagaaatgttgaacctcggtggtttaggacattcagca
gttattcattctacaaataaagaagtgcaaaagcaatttggattacgtatgaaagcttgc
cgtctcattgtaaatgcaccttcatcacaaggtggaataggggatatatataacggattt
attccatcacttacacttggttgtggttcttacggaaaaaattcagtttcccaaaatgta
acagcgactcatttattaaatataaaaaggctggcaaatagaaaaaagaatatgcagtgg
ttcaaattgccaccaaaaatttattttgaaaaacatgctacagcgtatttagcaaatatg
cctaacatttcacgtgcatttattgtaacggatcctggaatggttgaacatggctatgtg
gatacagtcacgcactatttaaacaagcatgcaaatgatgtgaaaattgaagttttcttt
gagatcgaaccagatccatcagatgaaactgtctttaaaggtgcggaaatgatgagaagc
tttaagccagatgtaattatcgcacttggtggtggttcagctatggatgcagcaaaagga
atgtggttattctatgagcatccagaaacgacattctatggcattaaacagaagttttta
gatataagaaaacgtacatgtaaatatccggaattaggaaataaggcacagtttgttgcg
attccaacaacatcaggaacaggatcagaagtgacaccatttgcggttattacagataag
aaaaataatataaagtatccgctcgcagattatgaattaacaccagatgtagcaattgtt
gatccacaatttgtaatgacagtaccaccacatgtaacagcagatactggtatggatgtt
ttaacacatgcaattgaggcgtatgtttctgttatggcaaatgactatacagatggatta
gcattaaaagctattgatctcgtattcaaatatttaccaagagcatataaagatggaaat
gatgaagaagcacgagaaaaaatgcataacgcttctgcaattgcagggatggcatttgca
aatgctttcctcggtattaatcacagcttagcacataagattggaccagaattccatatt
ccgcacggacgtgcaaatgccattctaatgccgcacgtagtccgctataatgctattaag
ccaagaaaacacgcattgttcccaaaatatgagcactttgtagcagatgaacgctatgca
catattgcgagaatgctcgggcttccagcaagctcagtagcagaaggtgtggaatcactc
gtcaaagcaattactgagcttggaaaaagcttaaatattaatatgagtattgcaggacaa
ggggtagataaagagcaatttgaagaggttgttggagtattagcagaaagagcttttgaa
gatcaatgtacaactgctaatccaaagttaccgcttatttcagagctgaaagaaatttat
atggaagcatataaaggtgaataa

DBGET integrated database retrieval system