KEGG   Bacillus thuringiensis HD-789: BTF1_20580Help
Entry
BTF1_20580        CDS       T02411                                 

Definition
helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:btn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BTF1_20580
Enzymes [BR:btn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BTF1_20580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3966385..3968721)
Genome map
AA seq 778 aa AA seqDB search
MGNQHAMDLFEEEKKFIKAQVLHTIFHNEENLYSVVSMKVIETNETYDEKKVMINGHFPR
MHEDEVFTLTGHFKDHPKYGKQYMVETFKKELPQTKAGMVQYLASDLFKGIGKRTAEKIV
DHLGEHAISKIMDDPEALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNGYGFGTKLSIKI
YQQYKEMTLEVIRNNPYQLIEEVDGIGFGRADDIGRALGISGNHDDRVRAGCFYTLENVS
LQLGHVYMRKDQLVRETMSLLNNQEGRVTEEDIIGCIETMQSEGKVIIEEERVYLATLFY
SEKGVVKSIRRLMNQEETPSFPEAEVLKTLGEIEEQLNVQYAPFQQEAIQTALHKPMMLL
TGGPGTGKTTVIKGIVEMYASLHGLSLNPNEYSDDNPFPILLTAPTGRAAKRMSESTGLP
ACTIHRLLGWTPEGSFQRNETDPVQGKLLIIDEFSMVDIWLANQLFKSLPTNIQVIVVGD
EDQLPSVGPGQVLKDLLNAGAVPTVKLTEIYRQAEGSSVIQLAHAIKDGTLPPDLAQNKK
DRSFISCTGAQIVEVVKKVCENAKTKGFSARDVQVLAPMYRGPAGINVLNEALQQVFNPK
REKSKEIAYGDVVYRRGDKVLQLVNQPESQVFNGDIGEIVSVFYAKENVEQQDMIIVSFD
GIEVTYTKPDLNQITHAYCCSIHKSQGSEFPIVIMPIVKSYNRMLRRNLIYTGITRSKKF
LIICGEEAAFKSGVNRLDDAMRQTTLASRLQESQGEVQMVTVNGEEMDVENISPYDFM
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcaacatgcaatggatttgtttgaggaagagaaaaagtttataaaagcgcaa
gttcttcataccattttccacaacgaagaaaacctctattccgttgtcagtatgaaagtc
attgaaacgaatgaaacatatgacgaaaagaaagtaatgataaacggtcattttccccgc
atgcatgaagatgaagtgtttacattgacaggtcactttaaggaccatccaaagtatgga
aaacaatatatggttgaaacatttaaaaaagaattgccgcaaacaaaagcaggtatggtg
caatatttagcgagtgatttatttaaagggataggaaagcgtacagcggaaaaaattgtg
gatcatctcggggaacatgctatttctaaaattatggatgaccctgaggcgttaaatggt
gttgttaacaaacaaaaggctcaggaaatatatgagacaattgttgaacatcaaggatta
gagaaagtaatgagctttttaaatggttacggttttggaacgaaactttctattaagatt
taccagcaatataaagagatgacattagaagtgattcgtaataatccgtatcaacttatt
gaagaagtggacgggattggttttggacgagcggatgatatagggcgtgcgttaggaata
tcgggtaatcacgacgaccgtgtacgagcgggatgtttttacacattagagaatgtctca
ttgcaacttggtcacgtttatatgaggaaagatcaacttgtaagagaaacgatgtcactt
ttaaacaatcaagaaggaagagtgactgaggaagatattataggttgtattgaaacgatg
caaagtgaagggaaagtcatcatagaagaagaacgagtgtatttagcaactttattctac
tctgaaaaaggtgttgtaaagtctattcgtcgattgatgaatcaagaggaaacaccttca
tttcctgaagcagaagtgttaaaaacattaggtgaaattgaagaacagttaaacgtgcag
tatgcaccgtttcagcaagaagcgattcaaacggcacttcataagccaatgatgttatta
acaggtggaccaggaacggggaaaacaactgttattaaagggattgttgaaatgtatgcg
tcacttcacggattatcgttaaatccgaatgaatacagtgatgataatccatttccaata
ctattaacagctccaacaggaagagcagcgaagcggatgagtgaatcgacaggacttcca
gcttgcacaattcaccgtttgcttggctggacgccagaaggatctttccagcgtaatgaa
acggatcctgtccaaggtaagctccttattattgatgaattttcaatggttgatatttgg
cttgcgaatcagctatttaagtcgctaccgacgaacattcaagttatcgttgtaggtgat
gaagatcagttgccatctgtaggacctggacaagtattaaaagatttattaaatgcaggc
gcagttccgacagtgaagcttactgaaatttatcgtcaagcagaaggctcatctgttatt
caacttgcccatgcaatcaaagacggcacgctcccgccagatttagcacaaaataaaaaa
gatcgttcatttatcagctgtacaggggctcaaattgttgaggttgtgaaaaaagtttgc
gaaaatgctaaaacaaaaggatttagtgcaagggatgtccaagtattagcgccgatgtac
cgcgggcctgctggtattaatgtattaaacgaagcattgcaacaagtatttaatccgaag
agggaaaagagtaaagaaattgcttacggtgatgttgtgtaccgaagaggcgataaagta
ctgcaactcgttaatcagccagagagccaggtgtttaatggtgatattggagaaattgtt
tcggtgttttatgcgaaagaaaacgttgagcaacaagatatgattatcgtttcatttgat
ggaattgaggtaacgtatacaaagcccgatttaaatcaaattacgcatgcatattgttgt
tccattcataaatcacaaggtagtgaatttccgattgttattatgccgatcgtgaaaagt
tacaaccgtatgttacgtcgtaatttaatttacacgggcattacaagaagtaagaagttc
cttattatttgcggggaggaagcagctttcaaatccggtgtaaatcgccttgatgatgca
atgcgtcaaacaactttggctagtcgcttgcaggaatcacaaggagaagtacagatggtc
acagttaatggcgaagaaatggacgtggaaaacatttcaccgtatgatttcatgtaa

DBGET integrated database retrieval system