KEGG   Bacillus thuringiensis HD-789: BTF1_22975Help
Entry
BTF1_22975        CDS       T02411                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:btn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4423281..4425218)
Genome map
AA seq 645 aa AA seqDB search
MSVINCEEVKRDELHTEKYYESYNIFGAHVVTEDEIQGVRFTVWAPHAKAMSVVGDFNEW
DYEQHKMLQVTEEGIWSLFIPHIEEGEIYKYAIETLAGDVILKADPYAIYAEVRPNTASV
VFDIKGYEWNDKNWTRKKKKKPIYKEAMTVYELHFGSWKKKEDGTLYSYREMVEELIPYV
VEHQFTHIEIMPLVEHPYDRSWGYQGTGYYAATSRFGTPHDLMYFVDECHKYGIGVILDW
VPGHFCKDAHGLYLFDGTPTYEYKDKDVQENPVWGTVNFDLGKREVRNFLISNALFWMRY
FHIDGFRVDAVANMLYWNKEGQEQSNEHAVSFLRELNEAVFAEDEDFLMTAEDSTAWPLV
TTPTYEGGLGFNYKWNMGWMNDVLKYMECAPEYRKHIHEKMTFSLLYAYSENFILPLSHD
EVVHGKKSLLNKMPGDYWDKFAQLRLLYGYFFTHPGKKLLFMGGEFGQFDEWKDLEDLDW
NLHDFEMHRYMHDYFKELIALYKRSKPLWQLDHSPEGFQWIDANNNEQSIFSFIRQGDKQ
EDALVVVCNFTKATYENYKVGVPDFEYYNEILNSDAEQYGGSGQVNKKRLKTILEPYHNQ
AAHVEITIPPFGVSILRPVKTRKGSKKQDGSKTKVRSNVTSRGKR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgtaataaattgtgaagaagtgaaacgagatgagttacatacagaaaagtactat
gaaagttataacatctttggcgcacatgttgtgacggaagatgagattcaaggggtacga
tttacagtgtgggctcctcatgcgaaagcaatgagtgttgttggagattttaatgagtgg
gattatgagcaacataagatgctacaagtgacagaagaaggcatttggtccttatttata
ccgcatattgaagaaggagaaatatataaatatgcgattgaaacgttggctggtgacgtc
attttaaaggcagatccgtatgctatatatgcagaagtaagaccgaatacggcatctgta
gtttttgatataaaaggatatgaatggaatgataaaaactggactcgtaagaaaaagaaa
aaaccgatttataaagaagcgatgacagtttatgaattacattttggttcttggaaaaag
aaagaagatggaacgctgtattcttacagggaaatggtagaagagctcatcccgtatgtg
gtggaacatcaatttacacatattgaaattatgccgcttgttgagcatccatatgatcgt
tcttggggatatcaaggaacgggatattatgcagcgacgagtagatttggtacgccgcat
gatttaatgtattttgtcgacgaatgtcataaatatggaatcggtgtcattttagattgg
gtgccggggcacttttgtaaagatgctcacggtttatatttgtttgatggcacaccgacc
tatgaatataaagataaagatgtacaagaaaatccagtatggggaactgtcaattttgat
ttagggaagagagaggtacgtaatttcttaatttcaaatgcgttattttggatgagatat
ttccatattgatggtttcagagtagatgcagttgcgaacatgttgtactggaataaagaa
ggacaagagcaaagtaatgagcatgctgtttcatttttaagagagttaaatgaagcagtg
tttgcagaggatgaagattttcttatgacggcagaagattcaacagcttggccacttgta
acaactccaacgtatgaaggtgggcttggattcaattacaaatggaacatgggctggatg
aatgatgtactgaaatatatggagtgtgcgcctgaatataggaaacacattcatgagaaa
atgacgttttctttactatatgcgtactctgaaaacttcatattaccactttctcatgat
gaagtcgttcatgggaaaaagtcgttattaaataaaatgccaggtgattactgggataag
tttgctcagcttcgtttattatatggatatttctttactcacccaggaaagaagttactt
ttcatgggaggagaattcggacagtttgatgagtggaaagaccttgaagatttagattgg
aatttacatgattttgaaatgcatcgttatatgcatgattactttaaagagctcatagca
ttgtataagcgctcaaaaccactttggcagcttgaccattcacctgaaggctttcagtgg
attgatgctaataataatgagcaaagtattttctcttttatccgccaaggggataaacaa
gaagatgcgttagttgtcgtatgtaattttacgaaagctacatatgaaaactataaagta
ggtgtaccagatttcgagtattataacgagattttaaacagtgatgctgagcaatatggc
ggttcggggcaagtgaataagaaacgtcttaagacgattctagaaccgtaccataatcaa
gcagcacatgtagagattacaattccaccatttggcgtatccatattacgaccagtgaag
acgagaaaggggagcaaaaaacaagatggctcaaaaacaaaagtgcgtagcaatgttact
agcagggggaaaaggtag

DBGET integrated database retrieval system