KEGG   Bacillus thuringiensis HD-789: BTF1_26150Help
Entry
BTF1_26150        CDS       T02411                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
btn  Bacillus thuringiensis HD-789
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:btn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5064842..5065438
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVC
GHITDRDPCYICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMEGIGPE
DINIPQLLKRLHDETVQEVILATNPNIEGEATAMYISRLLKPTGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagagccaatatcaaaactaatcgatagttttatgaagttgccaggtatc
ggaccgaaaacagcggttcgattggcatttttcgtattagatatgaaagaagatgatgtg
ttaggttttgcgaaagcacttgtaaatgcgaagcgagatttagcgtattgttctgtatgt
ggacatattactgatcgtgatccttgttatatttgtaatgattcgcatcgagatcaatca
gttgtttgtgtcgtgcaagaaccgaaagatgtaatcgcgatggaaaaaatgaaagagtat
caaggtgtatatcatgtgttacgtggtgcgatttctcctatggagggaattggaccggaa
gacattaatatcccgcaactcttaaagcgactacatgatgaaacggtacaagaagtaata
ttagcaacaaaccctaatattgaaggggaagctacagcgatgtatatctcccgcctctta
aaacctacaggcattaaagtaactcgtattgcacatggtctgccagttggtggagattta
gaatatgcagatgaagtgacactatcgaaagcgttagaaggtcgcagagaagtataa

DBGET integrated database retrieval system