KEGG   Bacillus thuringiensis HD-789: BTF1_26250Help
Entry
BTF1_26250        CDS       T02411                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:btn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BTF1_26250 (ipk)
Enzymes [BR:btn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BTF1_26250 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5085040..5085909
Genome map
AA seq 289 aa AA seqDB search
MKLLVKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLELTELAEDRIEILSHNRYV
PDDQRNLAYQAAKLLKEKFNVKKGVSITIEKTIPVAAGLAGGSSDAAATLRGLNKLWNLG
LTIDELAELGAEIGSDVSFCVYGGTAIATGRGEKIEHIKTPPSCWVILAKPHIGVSTADV
YGNLKLNRVTHPNVDKMVDVINSGDYKGICDTVGNVLEDVTFGMHPEVARIKSQMKRFGA
DAVLMSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYAVRLLGERETLE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctactagtgaaagcaccagcaaagattaatctgtcgttagatgtactgggaaaa
agacaagacggatatcatgaagtgaaaatgattatgacaaccattgatttagcagatcgt
ctagaactaacggaattagcagaagaccgtattgaaattttatcccataatcggtatgtc
ccagacgaccaacgaaatttagcttatcaggcagcgaaattattaaaagagaagtttaat
gtaaaaaaaggtgtatctattactattgaaaaaacgattccagtagcagctggattagca
ggtggaagtagtgatgcagcagcgacattacgtggtcttaataaattatggaatttaggg
cttacaattgatgagttagcagagcttggcgcagaaattggatcagatgtatcgttctgt
gtatacggcggcacagcaattgccactggaagaggagagaaaattgagcatataaagact
ccgccttcttgttgggttattttagcgaaaccacatataggtgtatctactgctgatgtg
tatggaaatttaaagttaaatcgagttacacatccaaatgtagataaaatggttgatgtc
ataaattctggagattataaagggatttgtgatactgttggtaacgttttagaagatgta
acatttggaatgcatcctgaagttgcacgtattaaatcacagatgaagcgattcggagcg
gatgctgtattgatgagtggaagtggtccaactgtatttggacttgtacaccatgattct
cgaatgcatcgcatttataacgggttaaaaggattttgtgaacaggtctatgcggtacgt
ttattaggagagcgagaaacgcttgaataa

DBGET integrated database retrieval system