KEGG   Bacillus thuringiensis HD-789: BTF1_26800Help
Entry
BTF1_26800        CDS       T02411                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:btn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BTF1_26800
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BTF1_26800
Enzymes [BR:btn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BTF1_26800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5195399..5196292
Genome map
AA seq 297 aa AA seqDB search
MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVKDMGDICIEREKEVDE
NTKLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGTLAGVAKHYKNLGVIWY
DAHGDLNTEETSPSGNIHGMSLAASLGYGHSSLVDLYGAYPKVKKENVVIIGARALDEGE
KDFIRNEGIKVFSMHEIDRMGMTAVMEETIAYLSHTDGVHLSLDLDGLDPHDAPGVGTPV
IGGLSYRESHLAMEMLAEADIITSAEFVEVNTILDERNRTATTAVALMGSLFGEKLK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaatttcagttattggagttccaatggatttaggacagatgcgtcgtgga
gttgatatgggaccgagcgcgatccgttatgcaggggtaattgaaagaattgaagaaatt
ggatatgacgttaaagatatgggagatatatgtatagagagagaaaaagaggtagatgaa
aatacaaaattaagaaaccttacacaagttgcaactgtatgtaatgaattagcaagtaag
gtggatcatattatagaagaaggtcgttttccacttgtattaggtggtgaccatagtatt
gctatcggtacattagctggtgtagccaaacattataaaaacttaggtgttatttggtat
gatgcacacggtgatctaaatacagaggaaacttcaccatctggaaatattcacggtatg
tcacttgcagcaagtttaggttatggacattcttcacttgtagatttatacggagcatat
ccaaaggtgaaaaaagagaatgttgtaattatcggtgcgcgtgcattagatgaaggagaa
aaagacttcattcgcaatgaaggtattaaagtgttctcgatgcatgaaattgatcgtatg
gggatgacggctgttatggaagaaacaatcgcatatttatctcatactgatggtgtacac
ttatcattagatttagatggtcttgatcctcatgatgcaccaggtgttggaacgcctgta
attggtggtctatcttatcgtgaaagccacttggcgatggaaatgttagcggaagctgat
attatcacatctgctgaatttgttgaggtaaatacgattttagatgagagaaatagaacg
gcaacaacagcagttgctttaatgggttctttattcggtgaaaaactaaaataa

DBGET integrated database retrieval system