KEGG   Bacillus thuringiensis HD-789: BTF1_27800Help
Entry
BTF1_27800        CDS       T02411                                 

Definition
(RefSeq) L-fuculose phosphate aldolase (EC:4.1.2.17)
  KO
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
btn  Bacillus thuringiensis HD-789
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btn00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BTF1_27800
Enzymes [BR:btn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BTF1_27800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5425757..5426398
Genome map
AA seq 213 aa AA seqDB search
MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPSGLEYYETKPEDVVIL
NLDGEVVEGERKPSSELDMHLIYYRNREDINALVHTHSPYAKTIASLGWELPAVSYLIAF
AGPNVRCAPYETFGTKQLADAAFEGMIDRRAVLLANHGLIAGANNIKMAFTVAEEIEFCA
QIYYQTKSVGEPKLLPEDEMENLAKKFEGYGQQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaaaaagaaagagaagaaattgtagcgtatggaaagaaaatgatctctagt
ggtttaacaaaggggactgggggtaatattagtattttcaatcgcgaacaaggtcttgtt
gcgattagtccaagtggtttagagtattatgaaacaaaacctgaagatgtagttatatta
aacttagatggtgaagtggtagagggagagagaaagccatcaagcgaactagatatgcat
cttatttattatagaaatcgtgaagatataaatgcgcttgtgcatacacattctccttac
gcaaagacgattgcgtcattaggatgggagcttcctgctgtttcatatttaattgctttc
gcaggcccgaatgttcgctgtgcaccgtatgaaacatttggtacgaagcaattagcggat
gctgcttttgaaggcatgattgatcgtcgtgctgtgctacttgcaaatcacggtttaatt
gctggtgcaaataatataaaaatggcgtttactgttgcagaagagattgagttttgtgct
caaatttattatcaaacgaaaagcgtcggagaaccgaagcttttgccagaagatgagatg
gagaatttggcgaagaagtttgaagggtatgggcagcagtag

DBGET integrated database retrieval system