KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_10130Help
Entry
WQG_10130         CDS       T02504                                 

Definition
Thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Brite
Enzymes [BR:bto01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     WQG_10130
Secretion system [BR:bto02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   WQG_10130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1089221..1089904
Genome map
AA seq 227 aa AA seqDB search
MKNSLITLLGFSLACSAFADDASLKKQLEKMGATNVVISPSALPNFKTAVTDQGVLQISE
NGRFVIQGQVFELKEGKAIDITNNALLAELNTLENEMIIYPAKNEKHVVTVFMDITCHYC
HILHSKLKEYNELGITIRYLAFPRGGMNTKTAKQMEAIWTADDKVFALNEAEKGNLPKEQ
KTPKIVKKHYELGLKFGVNGTPNMVTKEGELIRGYVEPKELAAMLNE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacagtctaattacattactcggattttcacttgcctgctcggcatttgctgat
gatgcaagcctaaaaaaacaattagaaaaaatgggggcaacaaatgtggtgattagccca
tcagcattgccaaatttcaaaacggcagtgacagatcaaggcgtgttgcaaattagtgaa
aatggtcgctttgtaattcaaggacaggtgtttgaactcaaagagggcaaggcgattgat
attaccaataatgcactattagctgaattaaacaccttggagaacgagatgattatttat
ccagctaaaaatgaaaaacatgttgtgactgtatttatggatattacttgccattattgc
catattctgcatagtaaacttaaagaatataatgaattgggtattactatccgttatttg
gcttttcctcgtggtggcatgaatacgaaaacagcaaaacaaatggaagcaatttggaca
gcagatgataaggtattcgctttaaacgaagcagaaaagggcaacctaccaaaagagcaa
aaaacacctaaaattgtgaaaaaacactatgaattaggcttaaaatttggggtaaacggt
acaccaaatatggtaaccaaagaaggagaattaattcgtggctatgttgagccgaaagaa
ttagcggctatgctaaacgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system