KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_11590Help
Entry
WQG_11590         CDS       T02504                                 

Definition
Glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bto00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    WQG_11590
  Amino acid metabolism
   00330 Arginine and proline metabolism
    WQG_11590
Enzymes [BR:bto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     WQG_11590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1262404..1263501
Genome map
AA seq 365 aa AA seqDB search
MHKTIVIKLGTSTLTHGTKSLSRPHMLEIVKQMANLHQQGHRLILVTSGAVAAGRDYLGH
RELPPTLASKQLLAAVGQSQLIQVWESLFSIYGIKIGQMLLTRADIENKDHFLNARDTLF
ALLEQGIIPVINENDAVATAEFRIGDNDNLSALVAMLAQAEQLILLTDQQGLFDSDPRKN
PAAKLLSVIEKITPEIRQIAGGSGSTLGTGGMFTKVVAAEIATRSGVETIIASGEHENVI
FEIVNGAAIGTRFLAQSDKIEGRKQWLFGAPPAGSITIDLGAENALLAQHKSLLPAGISA
VQGQFARGEVLKIQSSDGRILGLGISRYNSEALNQIKGKKSSEIETLLGYEFGAVVLHRD
EMILY
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaaccattgtgatcaaactggggactagcaccctcacccacggtacgaaaagt
ttaagccgtcctcacatgctagaaattgttaaacagatggccaatttacaccagcaagga
catcgcttaattttagttacttctggagctgtcgcggcagggcgagactatttaggacat
cgcgaactaccaccaacattggcaagcaaacagcttctcgctgcagtcggacaaagccaa
ttaattcaagtatgggaaagtctgttttcaatttatgggataaaaattgggcaaatgctc
ctcacccgtgcagatattgaaaataaagaccatttcttgaacgctcgtgatacattgttt
gcactactagaacaaggcattattcctgtaattaatgagaatgatgctgttgccaccgca
gaatttcgtatcggcgataacgataacctctccgccttagtggctatgctcgctcaagca
gagcagctaatattactcaccgaccaacaaggtttatttgatagcgatcctcgtaaaaat
cctgcggcaaaattacttagtgtgattgaaaaaatcacccctgaaattcgtcaaattgct
gggggaagtggttcaacgcttggcactggcggcatgtttaccaaagttgttgcggcagaa
attgcaacccgttcgggtgttgaaacaattattgcttcaggcgaacatgaaaatgtgatc
tttgaaattgtaaacggagcagcaattggtacccgtttccttgcgcaaagcgataaaatt
gaagggcgtaagcaatggttatttggtgctccaccggcgggaagtattaccattgattta
ggcgcagaaaatgcgttattagcacagcataaatccctcttgcctgctggaattagcgcg
gtacaaggtcaatttgcacgcggggaggtattaaaaattcaaagcagtgacgggcgaatt
cttggtttgggcatttcccgctacaatagtgaagcgcttaatcaaatcaaagggaaaaaa
tcaagtgagattgaaacgctcttgggctatgagtttggtgcagttgtactacaccgtgat
gaaatgattctttactag

  All links  
No link information was found.   
DBGET integrated database retrieval system