KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_11590Help
Entry
WQG_11590         CDS       T02504                                 

Definition
Glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bto01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bto00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1262404..1263501
Genome map
AA seq 365 aa AA seqDB search
MHKTIVIKLGTSTLTHGTKSLSRPHMLEIVKQMANLHQQGHRLILVTSGAVAAGRDYLGH
RELPPTLASKQLLAAVGQSQLIQVWESLFSIYGIKIGQMLLTRADIENKDHFLNARDTLF
ALLEQGIIPVINENDAVATAEFRIGDNDNLSALVAMLAQAEQLILLTDQQGLFDSDPRKN
PAAKLLSVIEKITPEIRQIAGGSGSTLGTGGMFTKVVAAEIATRSGVETIIASGEHENVI
FEIVNGAAIGTRFLAQSDKIEGRKQWLFGAPPAGSITIDLGAENALLAQHKSLLPAGISA
VQGQFARGEVLKIQSSDGRILGLGISRYNSEALNQIKGKKSSEIETLLGYEFGAVVLHRD
EMILY
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaaccattgtgatcaaactggggactagcaccctcacccacggtacgaaaagt
ttaagccgtcctcacatgctagaaattgttaaacagatggccaatttacaccagcaagga
catcgcttaattttagttacttctggagctgtcgcggcagggcgagactatttaggacat
cgcgaactaccaccaacattggcaagcaaacagcttctcgctgcagtcggacaaagccaa
ttaattcaagtatgggaaagtctgttttcaatttatgggataaaaattgggcaaatgctc
ctcacccgtgcagatattgaaaataaagaccatttcttgaacgctcgtgatacattgttt
gcactactagaacaaggcattattcctgtaattaatgagaatgatgctgttgccaccgca
gaatttcgtatcggcgataacgataacctctccgccttagtggctatgctcgctcaagca
gagcagctaatattactcaccgaccaacaaggtttatttgatagcgatcctcgtaaaaat
cctgcggcaaaattacttagtgtgattgaaaaaatcacccctgaaattcgtcaaattgct
gggggaagtggttcaacgcttggcactggcggcatgtttaccaaagttgttgcggcagaa
attgcaacccgttcgggtgttgaaacaattattgcttcaggcgaacatgaaaatgtgatc
tttgaaattgtaaacggagcagcaattggtacccgtttccttgcgcaaagcgataaaatt
gaagggcgtaagcaatggttatttggtgctccaccggcgggaagtattaccattgattta
ggcgcagaaaatgcgttattagcacagcataaatccctcttgcctgctggaattagcgcg
gtacaaggtcaatttgcacgcggggaggtattaaaaattcaaagcagtgacgggcgaatt
cttggtttgggcatttcccgctacaatagtgaagcgcttaatcaaatcaaagggaaaaaa
tcaagtgagattgaaacgctcttgggctatgagtttggtgcagttgtactacaccgtgat
gaaatgattctttactag

DBGET integrated database retrieval system