KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_12290Help
Entry
WQG_12290         CDS       T02504                                 

Definition
1,4-alpha-glucan branching enzyme GlgB
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:bto00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    WQG_12290
Enzymes [BR:bto01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     WQG_12290
Exosome [BR:bto04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WQG_12290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1362707..1364998
Genome map
AA seq 763 aa AA seqDB search
MTDKSLSPLLSEQDTHFITQLSAGICRDPFAYLGIHPSTHGVIIRAYLPEAQAVKIIDKN
ANPLAEMQRIDERGFFATELIGKKIDFSYRLLVSYAHTQIDIEDPYRFQSHLSDLDNWLL
SEGTQIRPYEKLGAHLVTQNDVGGIHFSLWAPNAQRVSVVGDFNLWDGRRHPMRFHPTSG
IWDIFIPNAKAGTLYKFEILDKNGTLRLKSDPYAFAAQFRPDTASVATGLPAIVEVDSKR
RAANNPDKPISVYEVHLGSWRRNLENNYWLSYEELAEELIPYVKEMGFTHIELLPISEFP
FDGSWGYQPTGIYAPTSRFGTPEGLRYLIQKAHDAGINVILDWVVGHFPTDEHGLAYFDG
THLYEHADPKEGYHQDWNTLIFNYGRYEVRNYLTANALYWIERFGIDALRVDAVASMIYR
DYSRADGQWIPNQYGGRENLEAIDFLRQTNDLLKQEGHGGITIAEESTSFAGVTHATQNH
GLGFNYKWNMGWMNDTLRYMQKDPIHRKYHHDLMTFGMVYQYSEQFMLPLSHDEVVHGKY
SLLGKMPGDCWQQFANLRAYYGYMWGYPGKKLLFMGNEFAQGREWNFQESLDWFLLDKGY
GGWHIGMQDWVKALNHLYQQTPALYELDYSPEGFEWLVVDDAEQSVFVFERKAKDGSSII
VISNFTAVVRENYRFGVHAPAKYREILNSDKEQYMGSGVENHALITTEEIASHGKNYSIS
VTLPPLSTIFLRKEYSGNINNLSRNIKHTPKTALKNKKKAKKK
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataaaagcctttctcctctcctttctgaacaagatacgcattttattacacaa
ctttctgcaggaatatgtcgcgatccctttgcctatttaggtattcatccttctacacat
ggggtgattattcgggcttatttacccgaagctcaagcggttaaaattattgataaaaat
gcaaacccactagctgaaatgcaacgaattgatgaacgagggttctttgccacggaatta
attggtaaaaaaattgatttttcctaccgcttgttggtttcctatgcccatactcaaatt
gatattgaagatccctatcgtttccaatcccacctttctgaccttgataattggctactt
tctgaaggcacacaaattcgtccatatgaaaaactaggtgcgcatttggttacccaaaat
gacgtgggcggtattcattttagtttatgggctcccaacgctcagcgtgtttcagttgtt
ggcgattttaacttatgggatggtagacgccacccaatgcgtttccacccaacaagtggt
atttgggatatttttattccaaatgcgaaagctggcacactatataaattcgaaatttta
gataaaaacgggacgttacgtttaaaatcagacccttatgcctttgctgcacaatttcga
ccagacaccgcttccgtagcaacaggtttacccgcaatcgtcgaagtggattcaaaacga
cgagctgcaaataatccagataaacctatttcggtttatgaagttcatctcggttcatgg
cgccgcaatctcgaaaacaattactggctaagctatgaagagcttgctgaagaactgatc
ccatatgtaaaagaaatggggtttacgcatattgaattattacctatttctgagtttcca
ttcgatggctcttggggctaccaaccaactggcatttatgcacccaccagccgctttggt
acgcctgaaggcttacgttatttaattcaaaaagcccatgatgcaggtattaatgtcatt
ctagactgggtggtaggacactttccaaccgatgaacacggtttagcctactttgatggc
acacacctttatgaacatgcagacccgaaagaaggctaccaccaagattggaatactctt
atttttaactatggcagatacgaagtgcgcaattatctcacggctaatgcgctttattgg
attgaacgttttggtattgatgccttacgcgttgatgctgtagcttcgatgatctaccgc
gactattctcgcgcagatggtcaatggattcctaaccaatatggcgggcgtgaaaatcta
gaagccattgattttttgcgccaaaccaatgatctgctaaaacaagaaggacatggcggt
atcacgatcgctgaagaatccacttcttttgcaggtgtcactcacgcaactcaaaaccat
ggtttaggctttaactataaatggaatatgggttggatgaatgacactttacgctatatg
caaaaagatccgattcatcgtaaatatcaccacgatttaatgacctttggcatggtgtac
caatatagtgagcaatttatgttaccactctcacacgatgaagtggtgcatggcaaatat
tctcttttagggaaaatgcctggggactgctggcaacaatttgccaacctacgggcttac
tatggctatatgtggggttatcctggtaaaaaattactctttatgggcaatgaatttgcc
caagggcgtgaatggaatttccaagaaagcttagattggttcttgctagataagggctac
ggtggctggcatatcggtatgcaagattgggtcaaagcacttaatcacctctatcaacaa
acccctgcgctttacgaacttgattattctccagaaggttttgaatggttagttgtcgat
gatgcagagcaatccgtctttgtatttgagcgtaaagcaaaagatggttcaagcattatt
gtaatcagtaactttactgctgtagtacgcgaaaattatcgctttggcgtacatgcaccg
gcaaaataccgtgaaattctaaactcagataaagaacaatatatgggaagtggcgttgaa
aaccacgctcttatcacgacagaagaaatagcctcccacggtaaaaactactcgatcagt
gtgacattaccgccactttcaaccatttttttgcgtaaagagtactcaggcaatataaac
aacctctcccgtaacataaaacatacgcccaaaactgcactaaaaaataagaaaaaagcg
aagaaaaaataa

DBGET integrated database retrieval system