KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_12640Help
Entry
WQG_12640         CDS       T02504                                 

Definition
Thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bto00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    WQG_12640
Enzymes [BR:bto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     WQG_12640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1402644..1403222
Genome map
AA seq 192 aa AA seqDB search
MAKLYFYYSSMNAGKSTTLLQSAYNYQERGMRPLVYTAAIDDRYGVGKVASRIGISQQAN
LFDKNSDLFAEISQEHHKQTLHCILVDEAQFLTKQQVYQLSEVVDKLGIPVLCYGLRTDF
QAELFEGSRYLLAWADQLEELKTICYCGRKANFVIRLNQHGEVVKDGEQIQIGGNDSYLS
VCRRHYKEKLAK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattatacttctactattcctcaatgaatgcagggaaatccacaaccctactt
caatctgcttataactatcaagaacgtggcatgcgcccgttggtatatacagcagcaatt
gatgatcgctacggcgtaggcaaagttgcctcacggattggtatatcccaacaggcaaat
ctttttgataaaaattcagacctcttcgctgaaattagccaagaacaccacaaacaaaca
ttgcattgtatcttggtggatgaggctcaatttctcaccaaacaacaggtatatcaatta
agtgaagttgtagataaattaggtatccctgttctttgctatggactacgcactgatttc
caagcagagctttttgaaggaagccgttatctcttagcttgggcagatcaattagaagag
ctgaaaactatctgttattgtgggcgcaaagcaaattttgtgatacgtttaaatcaacat
ggcgaagtggttaaagatggtgaacaaattcaaattggcggcaatgatagctacctgtct
gtttgtcgccgacactataaggaaaagttagctaaataa

DBGET integrated database retrieval system