KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_13690Help
Entry
WQG_13690         CDS       T02504                                 

Definition
hydrolase
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bto00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1509934..1510590)
Genome map
AA seq 218 aa AA seqDB search
MNEISLEAKQVRQALVAKGIETPTVALTQSKAVRRDKIEQKMRDVLELLGLDLNDDSLEE
TPKRLAKMYVDEIFSGLDYTTFPKITKIQNRMKVSEMVLVDDITLTSTCEHHFVTIDGKV
AVAYYPKDWVIGLSKINRVVQFFAQRPQVQERFTEQILTAFQTILETEDVAVYVKATHFC
VKCRGVRDTNSQTITSAYGGVFLQDRETRKEFLAQIQK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaatctcactggaagccaaacaggttcggcaagcattggttgccaaaggtatt
gaaacaccaacggttgctcttactcagtctaaagccgtacgtcgcgataaaattgaacaa
aaaatgcgtgacgtattagaattattaggcttagatttaaatgacgacagtttggaagaa
acgccaaagcgcttagccaaaatgtatgtcgatgaaattttcagtgggctagattatacg
accttcccaaaaatcaccaaaatccaaaaccgtatgaaagtcagcgaaatggtgttggtc
gatgatataactttgactagcacttgcgagcaccactttgtcactattgatggtaaagtt
gccgttgcatattatcctaaagattgggtgattggcttatctaagatcaaccgtgtggtg
caattttttgctcaacgtccacaagtgcaagagcgttttacggagcagattttaacagca
tttcaaaccattttagagacggaagacgtggcggtttatgttaaagcaacccatttctgc
gtaaaatgtcgtggtgtgcgcgataccaatagtcaaacgattacttcagcttatggtgga
gtctttttgcaagatcgtgaaactcgcaaagaatttcttgcccaaatccaaaaatga

DBGET integrated database retrieval system