KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_13690Help
Entry
WQG_13690         CDS       T02504                                 

Definition
(GenBank) hydrolase
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
bto00790  Folate biosynthesis
bto01100  Metabolic pathways
Module
bto_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bto00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    WQG_13690
Enzymes [BR:bto01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     WQG_13690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AGH38646
UniProt: M4R684
Position
complement(1509934..1510590)
Genome map
AA seq 218 aa AA seqDB search
MNEISLEAKQVRQALVAKGIETPTVALTQSKAVRRDKIEQKMRDVLELLGLDLNDDSLEE
TPKRLAKMYVDEIFSGLDYTTFPKITKIQNRMKVSEMVLVDDITLTSTCEHHFVTIDGKV
AVAYYPKDWVIGLSKINRVVQFFAQRPQVQERFTEQILTAFQTILETEDVAVYVKATHFC
VKCRGVRDTNSQTITSAYGGVFLQDRETRKEFLAQIQK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaatctcactggaagccaaacaggttcggcaagcattggttgccaaaggtatt
gaaacaccaacggttgctcttactcagtctaaagccgtacgtcgcgataaaattgaacaa
aaaatgcgtgacgtattagaattattaggcttagatttaaatgacgacagtttggaagaa
acgccaaagcgcttagccaaaatgtatgtcgatgaaattttcagtgggctagattatacg
accttcccaaaaatcaccaaaatccaaaaccgtatgaaagtcagcgaaatggtgttggtc
gatgatataactttgactagcacttgcgagcaccactttgtcactattgatggtaaagtt
gccgttgcatattatcctaaagattgggtgattggcttatctaagatcaaccgtgtggtg
caattttttgctcaacgtccacaagtgcaagagcgttttacggagcagattttaacagca
tttcaaaccattttagagacggaagacgtggcggtttatgttaaagcaacccatttctgc
gtaaaatgtcgtggtgtgcgcgataccaatagtcaaacgattacttcagcttatggtgga
gtctttttgcaagatcgtgaaactcgcaaagaatttcttgcccaaatccaaaaatga

DBGET integrated database retrieval system