KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_16720Help
Entry
WQG_16720         CDS       T02504                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bto00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    WQG_16720
Enzymes [BR:bto01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     WQG_16720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1835442..1837406)
Genome map
AA seq 654 aa AA seqDB search
METQDYFFDGFNSAFATHQAVAQLLGQAQVQALLPPVQVVEQGQAVEIPLNFTNFSEWQL
QLETGEVFTGIPENGRIVLPSDLPLGYHEVTLADAQCRLIITPKTAYQPKEILAKKKLWG
AILQLYTLRSEQNWGIGDFGDLAQFLTYLARQGGDFVGLNPIHSLFPANPEAASPYSPSS
RLWQNILYIDVTAIPAFQNSLQAQEWFQQPETQQKLNAARTCDYISYSLVTQLKLQGLAL
AYEQFKQEDQTDFEQFIVEKGEQLKIQGTFDALHQWLSEQYPAQWGWSNWASEWQDYTSP
QVADFQQQQPERIRFYMWLQFIASQQLKACYELAKQLNMPIGFYRDLAVGVANNGAETWS
DKSLYVLGASIGAPPDMLAPQGQNWGLSPMHPSVLQARAYQPFIDLLRANMQDCGALRID
HILGLMRLWWVLQGGSAVEGVYIRYPFEDLLGILALESQRHRCLIIAEALGTVPEGILEA
LEQKGILAYNVFYFEFEDGKSKPLSHYPYQAMTTLSTHDLPTINGYWQEYDIALGQHYDI
YPSQAILDFVQENRSLSKKAFCEVLAKIGILASNDKMPISSAFNHQLQSYVAHTNSALYA
TQPEDWLNMLEPVNIPGTSSEHPNWRRKLSKPITAIFSDESILALLNSIQQNRT
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacaagattacttttttgatggttttaatagtgcttttgcgactcaccaagcc
gtggctcaattattagggcaagcccaagtacaagcattacttcccccagtacaggttgtg
gagcaaggacaagcggttgaaattccgctaaattttacaaatttttcagaatggcaatta
caactggaaaccggcgaggtatttacggggattcctgaaaatgggcggattgtgctgcca
tcagatctgccattgggctaccatgaggtgacattggctgatgcacaatgtcgcttaatt
attacaccgaaaactgcttatcaaccgaaagaaattttggctaaaaagaaactttgggga
gcaattttacagctttataccctccgttctgaacaaaattggggaattggagactttggc
gatttagcccaatttctcacttatttagcacggcaaggtggtgattttgtggggttaaac
ccaattcactctttatttcctgctaatccagaagctgcaagcccttatagtccctcatca
cgcttatggcagaatatactctatattgatgtaaccgccatacctgctttccaaaatagt
ctccaagctcaagagtggtttcagcagccagaaacacagcagaaattaaatgctgcgcga
acttgtgattatatttcgtactccttagttactcagctaaaattacaaggcttagccctt
gcttatgaacagtttaaacaagaagatcaaactgatttcgaacaatttattgtagagaaa
ggcgaacagttaaaaatacaaggcacttttgatgcgttacatcaatggctatccgagcaa
tatcctgctcaatggggttggagtaattgggcaagcgaatggcaagattatacttcacca
caagttgcagattttcagcaacaacagcctgagcgtattcgcttttatatgtggctacaa
tttattgctagccaacaactcaaagcttgttatgagttagccaaacagctcaatatgcca
attgggttttaccgcgatttagcggttggcgtggcaaacaatggtgcggaaacttggtcg
gataaatccctttatgtgctgggagcaagtattggggcaccaccagatatgcttgcgccc
caagggcaaaattgggggctatcgcccatgcatccaagcgtattgcaagcacgagcctat
caaccctttatcgatctattacgtgcaaatatgcaagattgtggagcattacgcatagac
catattctaggcttaatgcgtttatggtgggtactacaaggtggcagtgcagtagaaggg
gtttatattcgttatccttttgaggatttgcttggtattttggctttagagagccaacgc
caccggtgcttgattattgcagaagcattggggactgtgccagagggtatcttagaggca
ttagagcaaaaaggcattctcgcttataacgtattctattttgaatttgaagatggtaag
agcaaaccgctttcgcattatccataccaagcaatgaccacactcagtactcacgatctg
cctacgattaacggttattggcaggagtatgatattgcgcttggtcagcattatgatatt
tatccaagccaagcgattttagactttgtgcaagagaatcgctctttgagtaaaaaagca
ttttgtgaagtattagctaaaatagggattctggcaagcaatgataaaatgcctataagt
tctgctttcaatcatcaactgcaaagctatgttgcacatactaattcagcactctatgca
actcagcccgaagattggctgaatatgttagaacccgtgaatattccgggaacaagttct
gagcatccaaattggcggagaaaattatcaaagcctattactgcaattttctctgatgag
tcaatattagcattgttaaactcaattcagcagaatcgcacttaa

DBGET integrated database retrieval system