KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_4940Help
Entry
WQG_4940          CDS       T02504                                 

Definition
Histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bto00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    WQG_4940
  Amino acid metabolism
   00340 Histidine metabolism
    WQG_4940
Enzymes [BR:bto01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     WQG_4940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
503225..504544
Genome map
AA seq 439 aa AA seqDB search
MWGRRKNMQTLIWNQLSPTEQQSALARPAISASNELKSAVENILDLVKTQGDKALFDLTA
KFDKTQLSSLAVSAEQIQAACERVSPALKTAIANAKANITTFHEAQKPQEVDIETQAGVR
CQVLTRAIEKVGLYIPGGSAPLFSTVLMLAVPAKIAGCKKIVLCTPPPIADEILYTAWLC
GVDTIYAVGGAQAIAGMAFGTESVTKVDKIFGPGNAFVTEAKRQVSQRFDGAAIDMPAGP
SEVLVIANEYADPDFVASDLLSQAEHGADSQVMLVTDSLELAEKTKQSIERLLADLSRKE
TACKALSHSRIIVADDLYQCAQISNAYAPEHLVVQIENPRNLLGWLDNAGSIFLGAYSPE
SMGDYASGTNHVLPTYGYTRTHSSLGLADFSKRMTVQELTPQGFKALAPTVMAMAEAEQL
AAHKLAVEVRLEKLDFVKN
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
gtgtggggaaggagaaaaaatatgcaaaccctcatttggaaccaattatcccccactgaa
caacaaagcgctttggcgcgccctgccatttctgcctccaatgagctgaaaagtgcggta
gaaaatatcttagatttggtgaaaacccaaggcgacaaagcgctttttgacttgaccgcc
aagttcgacaaaacccaactttcaagcctcgccgtatctgccgagcaaattcaagcagca
tgtgagcgagtatcccccgcgctgaaaaccgccattgccaatgctaaagccaacatcacc
actttccacgaggcgcaaaagccgcaagaggtagatattgaaactcaagcaggcgtgcgt
tgccaagtgctgacaagggcgattgaaaaagtcggcttgtatattccgggaggttctgcg
cctttattttcaaccgtgttgatgcttgccgtgcctgccaaaatcgcaggttgcaagaaa
attgtactttgcacaccgccaccgattgcagacgaaattctctacaccgcatggctttgt
ggcgtggacaccatttatgcggtgggcggtgcgcaggcgattgcaggtatggcattcggt
acagaaagcgtgaccaaagtagacaaaattttcgggccgggcaatgcgttcgttaccgaa
gccaaacgccaagtcagccaacgatttgacggcgcagccattgatatgcctgcagggcct
tcggaagtgctggtgattgccaacgaatacgccgaccctgattttgtggcaagcgatctg
ctctcccaagccgaacacggtgcggacagccaagtgatgctcgtgaccgacagcctcgaa
cttgccgaaaaaaccaagcaatccattgaacgtctgcttgcagatttatctcgtaaagag
accgcttgcaaagcgctttcccacagtcgcatcatcgtggcggacgacctctaccaatgc
gcccaaatcagcaacgcctatgcgcctgaacaccttgtggtacaaatcgaaaacccacgc
aatctgcttggctggttagataacgcaggctcgattttcttaggcgcgtacagccctgaa
agtatgggtgattacgccagcggcaccaaccacgttctgcccacctacggctacacccgc
acccattccagccttgggcttgcggatttcagtaaacgtatgaccgtgcaagaactcacc
ccacaaggcttcaaagcgcttgccccaacggtgatggcaatggcagaagcagaacagctg
gcggcgcataagctcgcggtggaagtgcggttggaaaagttggattttgtaaaaaattaa

DBGET integrated database retrieval system