KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_6060Help
Entry
WQG_6060          CDS       T02504                                 

Definition
Iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bto00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    WQG_6060
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WQG_6060
   00620 Pyruvate metabolism
    WQG_6060
   00650 Butanoate metabolism
    WQG_6060
  Lipid metabolism
   00071 Fatty acid degradation
    WQG_6060
  Amino acid metabolism
   00350 Tyrosine metabolism
    WQG_6060
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    WQG_6060
   00626 Naphthalene degradation
    WQG_6060
Enzymes [BR:bto01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     WQG_6060
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     WQG_6060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(641391..644081)
Genome map
AA seq 896 aa AA seqDB search
MGFLLQKRIIFTSKIILKLYGETKMTAKKVVEAQPYDAQVEVNELVERGLKALDAFRLLD
QAQVDYIVAKASVAALDQHGVLAQHAVEETGRGVFEDKATKNLFACEYVVNNMRHLKTAG
VISEDDVTGITEIADPVGVVCGITPTTNPTSTTIFKALIALKTRNPIVFAFHPSAQQCSA
HAAQIVYDAAVAAGAPKNCIQWIKTPSMEGTSLLMKHKGIATILATGGNAMVEAAYSCGK
PALGVGAGNVPAYVEKSAKLKQAVYDIVMSKSFDNGMICASEQAAIVDKEIYNEFVQEMQ
SYGVYLVNKKEKALLEQFIFGVDKADKASCAGAKLNSAVVGKSAFWIAEQAGFSVPKNTN
ILLAECKEVGELEPLTREKLSPVLALLKADNTEHGLQLAEAMVNFHGLGHSAAIHTQNSE
LAKTFGERVKAIRVIWNSPSTFGGIGDVYNSFLPSLTLGCGSYGKNSVGNNVSAVNLLNI
KRVGRRRNNMQWFKVPSKIYFERDSIQYLKSMKDAEKVMIVTDRAMVDLGFVDRITEQLR
QRRNKVTYQLFCDVEPNPSIETVRKGTELMRSFQPDTIIALGGGSPMDAAKVMWLFYEQP
EVDFRDLVQKFMDIRKRAFKFPQLGRKAKFVGIPTTSGTGSEVTPFAVITDGDIKYPLAD
YSLTPTVAIVDPALVMSVPPAVAADTGLDVLTHATEAYVSVLANDYTDGLALQAIKLVFE
NLEKSVKEFDEVAREKMHNASTMAGMAFANAFLGICHSMAHKIGGKFHTIHGRTNAILLP
HVIRYNGTRPTKVATWPKYTDYVADRRYQDIARMLGLPASTPAEGVESYAKAVHDLSVRC
GVKMSLKEQGIDEKAFLEARRELAFNAFEDQCTPANPRLAMVADMEELMTKAYYGK
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
gtgggatttttactccaaaagcgtattatttttaccagtaaaataattttaaaactttat
ggagaaactaaaatgacagcaaaaaaagtggttgaagctcaaccgtatgatgctcaagtc
gaagttaatgaactggttgaacgcgggcttaaagcattggatgctttccgtctacttgac
caagcccaagtcgattacattgtggcgaaagcctctgttgccgctcttgatcagcatggt
gtgcttgcccaacatgcggtagaagaaacaggacgtggggtatttgaggataaagccact
aaaaacctcttcgcttgtgaatatgtcgtcaataatatgcggcatcttaaaaccgcaggt
gtaattagtgaagacgatgtcactggtatcactgaaatagccgatcctgtcggggtcgtt
tgtggtatcactccaacaaccaatccaacctctaccacaatcttcaaagcactaatcgct
ctcaaaactcgtaaccctatcgtttttgccttccacccttctgcacaacaatgctctgca
cacgcagcacaaattgtctatgatgctgctgttgcggcaggtgcaccaaaaaattgtatc
caatggattaaaaccccatcaatggaaggcacatctttattaatgaaacacaaaggcatt
gcgaccattcttgccactggcggaaatgctatggttgaagcagcttactcttgtggtaaa
ccagcactgggcgtgggagcaggcaatgtgccagcctatgtagagaaaagtgctaaactc
aaacaagcggtgtatgacattgtaatgtcaaaatcatttgataacggtatgatttgtgcc
tctgagcaagccgctattgtagataaagagatctacaatgagtttgtacaagagatgcaa
tcttatggcgtatatttagtgaataaaaaagagaaagccctgcttgaacaatttattttc
ggggttgataaagccgataaagcaagctgtgcaggcgcaaaattaaattcggcagtagtg
ggaaaatctgccttttggattgcagaacaagcgggcttttctgtgccgaaaaataccaat
attttattggctgagtgtaaagaggtgggcgaacttgaaccacttacccgtgaaaaactt
tcgcctgttttagcattgttaaaagccgataataccgaacacggtttacaacttgctgaa
gcaatggtgaatttccatggcttaggacattcggcggcaatccatacccaaaatagcgaa
cttgctaaaacgtttggggaacgtgtaaaagccattcgtgtcatttggaactcgccttct
acctttggtggtattggtgatgtttataactcattcttgccatcactcacattaggttgt
ggctcttacggtaaaaactctgtgggcaacaatgtaagtgcagtgaacttattaaatatt
aaacgggttggcagacggagaaataatatgcagtggtttaaagtgccatcaaaaatctac
tttgagcgcgattctattcaatatttaaaatcaatgaaagatgcggaaaaagtcatgatc
gtcaccgaccgggcaatggtcgatctcggttttgtcgatagaattaccgaacaattacgc
caacgccgtaataaagttacctaccagctgttctgcgatgtagagccaaacccaagtatt
gaaaccgtgcgtaaaggcacagaacttatgcgtagcttccaaccagatactatcatcgca
ttaggcggtggttcaccaatggatgccgctaaagtgatgtggcttttctatgaacaacca
gaagtcgatttccgtgatttagtgcaaaaatttatggatattcgcaaacgcgcctttaaa
ttcccacaattaggacgcaaagccaaatttgttgggatcccaaccacttcgggtacaggt
tctgaagtgactccatttgcagtgattaccgatggtgacattaaatatcctcttgcggat
tattctttaacgccaacagtcgcgattgtcgatcctgcattagtgatgtctgtcccaccc
gcagttgctgctgataccggtttagatgtgctcacacatgcaacagaggcttacgtttct
gtgcttgcaaatgattatactgatggcttggcattacaagcgattaaattggtctttgaa
aatcttgaaaaatcggtcaaagaatttgatgaagttgcacgtgaaaaaatgcacaacgct
tcaaccatggcaggtatggcatttgctaatgcattccttggtatttgccactcaatggca
cacaaaattggcggtaaattccatactattcacggtcgtaccaatgctatcttattgcca
cacgttatccgttataacggtactcgcccaaccaaagtggcaacttggccgaaatatact
gattatgtggctgatcgccgctatcaagatattgcccgcatgcttggcttaccagcaagc
acacctgctgaaggggtggaatcttacgcgaaagcagtgcacgatctttctgtacgctgt
ggcgtgaaaatgtcattaaaagagcaaggtattgatgaaaaagcgttcttagaagcccgt
cgagaactggcattcaacgcctttgaagaccaatgtacccctgctaacccacgtcttgcg
atggttgcggatatggaggagttaatgaccaaagcctactatggcaaataa

DBGET integrated database retrieval system