KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_8420Help
Entry
WQG_8420          CDS       T02504                                 

Definition
Uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bto00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
912961..913719
Genome map
AA seq 252 aa AA seqDB search
MNVLVTRPDERGQQLVNMLAERQIFAIHQPILRIEAGNALPQLPSVLARLNAGDYVFAVS
KNAVDFAVKALKETGFRWRSDLTYLAVGQGTANYFCSQAELSVRYPIESENSEGLLNLAG
MQNLADKQVVILRANTGREYFSEQVQLRGAKVETVECYRRLLWAEDLPEKMSLAKRSGID
TLVITSGEILSTLFTQTLETDRDWLLASRLIVVGRRVANLAIKLGWQSDLITISEKADNY
SLLESVLQGMKS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtattagttactcgccctgatgaacgagggcaacagctggttaatatgttagca
gaacggcaaatttttgcgattcatcagcctattttgcgtattgaggctgggaatgcgttg
ccacagctgccttctgttcttgcgcgtttaaatgcgggtgattatgtctttgccgtttct
aaaaatgcggtagattttgcggtaaaagcattaaaagaaacgggttttagatggcgaagt
gatttaacttatttagcggtagggcaggggactgcaaattatttctgtagtcaagcagag
ttgtcggttcgctatccaattgagagcgaaaatagcgaaggtttactcaatttagccggt
atgcagaatcttgcggataagcaagtagtgattttacgtgcgaatacgggacgagagtat
tttagtgagcaggttcagctacgaggggcaaaggtagaaacggttgaatgctatcgtcgt
ttattgtgggcagaggatttgcctgaaaaaatgagcttggcaaaacgttctggtattgac
actttagttatcactagtggtgagattttatcaacactatttacgcaaacgttagagacc
gatcgagactggttattggcatctcgtttaattgtggttggacgtagagtggcgaattta
gcaataaaattaggttggcaaagtgatttaattacgatttcagaaaaagcagacaactac
agcttgctggaatcggtgttgcaaggtatgaaatcttaa

DBGET integrated database retrieval system