KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_8420Help
Entry
WQG_8420          CDS       T02504                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
bto00860  Porphyrin and chlorophyll metabolism
bto01100  Metabolic pathways
bto01110  Biosynthesis of secondary metabolites
bto01120  Microbial metabolism in diverse environments
Module
bto_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:bto00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    WQG_8420
Enzymes [BR:bto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     WQG_8420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AGH38119
UniProt: M4R8N0
Position
912961..913719
Genome map
AA seq 252 aa AA seqDB search
MNVLVTRPDERGQQLVNMLAERQIFAIHQPILRIEAGNALPQLPSVLARLNAGDYVFAVS
KNAVDFAVKALKETGFRWRSDLTYLAVGQGTANYFCSQAELSVRYPIESENSEGLLNLAG
MQNLADKQVVILRANTGREYFSEQVQLRGAKVETVECYRRLLWAEDLPEKMSLAKRSGID
TLVITSGEILSTLFTQTLETDRDWLLASRLIVVGRRVANLAIKLGWQSDLITISEKADNY
SLLESVLQGMKS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtattagttactcgccctgatgaacgagggcaacagctggttaatatgttagca
gaacggcaaatttttgcgattcatcagcctattttgcgtattgaggctgggaatgcgttg
ccacagctgccttctgttcttgcgcgtttaaatgcgggtgattatgtctttgccgtttct
aaaaatgcggtagattttgcggtaaaagcattaaaagaaacgggttttagatggcgaagt
gatttaacttatttagcggtagggcaggggactgcaaattatttctgtagtcaagcagag
ttgtcggttcgctatccaattgagagcgaaaatagcgaaggtttactcaatttagccggt
atgcagaatcttgcggataagcaagtagtgattttacgtgcgaatacgggacgagagtat
tttagtgagcaggttcagctacgaggggcaaaggtagaaacggttgaatgctatcgtcgt
ttattgtgggcagaggatttgcctgaaaaaatgagcttggcaaaacgttctggtattgac
actttagttatcactagtggtgagattttatcaacactatttacgcaaacgttagagacc
gatcgagactggttattggcatctcgtttaattgtggttggacgtagagtggcgaattta
gcaataaaattaggttggcaaagtgatttaattacgatttcagaaaaagcagacaactac
agcttgctggaatcggtgttgcaaggtatgaaatcttaa

DBGET integrated database retrieval system