KEGG   Bibersteinia trehalosi USDA-ARS-USMARC-192: WQG_8900Help
Entry
WQG_8900          CDS       T02504                                 

Definition
Glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bto  Bibersteinia trehalosi USDA-ARS-USMARC-192
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bto00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WQG_8900
   00330 Arginine and proline metabolism
    WQG_8900
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    WQG_8900
Enzymes [BR:bto01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     WQG_8900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
961313..962227
Genome map
AA seq 304 aa AA seqDB search
MNYQTIISTIYQRIRAEENGGELAMYIPELANISPDKFGVAYFDLKDSTIGVGDYQEKFS
IQSIVKVLSLVFAYKHLGDSIWKRVNVEPSGTSFNSLLQLETDCGIPRNPFINAGAIVIC
DILLSLFENPKQAFLDFVRDLANNSNIHYSEKVAESEKAVGYRNFALCYYIKSFGNIQND
PNEVLDFYFHICSIEMSCEEIAYAFSFLANDGVKLHDNQQVLNKSQIKRTNALMQTCGFY
DESGEFAFRVGLPGKSGVGGGIVAIMPNHHCITVWSPKLNEKGNSYRGMKFLEEFTTQTK
ISVF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaattaccaaacgattatttcaactatttatcaacgtattcgcgctgaagaaaatggt
ggggaattagcaatgtatattccagagcttgctaatattagccccgataaatttggtgtt
gcctattttgatttaaaagatagcactattggtgtgggcgattatcaagaaaaattttcc
attcagagtatcgtaaaagtactgtcgctggtgtttgcttacaaacatctaggtgatagc
atttggaagcgagtaaatgtggagccttcaggcacgtcgtttaattcccttttgcagtta
gaaacagattgtggcattccacgtaatccctttatcaatgccggtgcaatagtgatttgc
gatattttgctttcgctatttgaaaatcctaagcaggcctttttagattttgtacgcgat
ctggctaataattcaaatattcattatagcgaaaaagtagcagaatcagaaaaagcagtt
ggctatcgtaattttgctttatgctattacattaaatcttttggcaatattcaaaatgat
ccgaatgaggtgttggatttttattttcatatctgctcaattgaaatgagctgtgaagag
attgcttatgcatttagttttttagcgaatgatggcgtgaaattgcacgataaccagcag
gtgttaaataaaagccaaataaaacgtaccaatgcattaatgcaaacttgcgggttttat
gatgaatcgggtgaatttgcttttcgtgtgggcttaccgggtaaaagcggtgtcggtggt
ggtattgtggcgattatgccaaatcatcattgtattacggtgtggagcccgaaattaaat
gagaaaggaaattcctatcgtggaatgaagtttttagaagaatttactacacaaacgaaa
atctcggtgttttaa

DBGET integrated database retrieval system